Rabbit anti-Human RFXAP Polyclonal Antibody | anti-RFXAP antibody

RFXAP (Regulatory Factor X Associated Protein, Regulatory Factor X-associated Protein, RFX-associated Protein, RFX DNA-binding Complex 36kD Subunit) APC

Cat. Num. AAA6392409

• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RFXAP; Polyclonal Antibody; RFXAP (Regulatory Factor X Associated Protein; Regulatory Factor X-associated Protein; RFX-associated Protein; RFX DNA-binding Complex 36kD Subunit) APC; anti-RFXAP antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human RFXAP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 2341

• Applicable Applications for anti-RFXAP antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human RFXAP, aa1-272 (AAH26088.1).
• Immunogen Sequence: MEAQSVAEGAGPGAASGVPHPAALAPAAAPTLAPASVAAAASQFTLLVMQPCAGQDEAAAPGGSVGAGKPVRYLCEGAGDGEEEAGEDEADLLDTSDPPGGGESAASLEDLEDEETHSGGEGSSGGARRRGSGGGSMSKTCTYEGCSETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKSDQALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGTSM
• Conjugate: APC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(RFXAP rabbit polyclonal antibody. Western Blot analysis of RFXAP expression in human kidney.)

Western Blot (WB)

(Western Blot analysis of RFXAP expression in transfected 293T cell line by RFXAP polyclonal antibody. Lane 1: RFXAP transfected lysate (28.3kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-RFXAP antibody

Major histocompatibility (MHC) class II molecules are transmembrane proteins that have a central role in development and control of the immune system. The protein encoded by this gene, along with regulatory factor X-associated ankyrin-containing protein and regulatory factor-5, forms a complex that binds to the X box motif of certain MHC class II gene promoters and activates their transcription. Once bound to the promoter, this complex associates with the non-DNA-binding factor MHC class II transactivator, which controls the cell type specificity and inducibility of MHC class II gene expression. Mutations in this gene have been linked to bare lymphocyte syndrome type II, complementation group D. Transcript variants utilizing different polyA signals have been found for this gene.

Product Categories/Family for anti-RFXAP antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 19913537
• NCBI GeneID: 5994
• NCBI Official Full Name: Homo sapiens regulatory factor X-associated protein, mRNA
• NCBI Official Synonym Full Names: regulatory factor X associated protein
• NCBI Official Symbol: RFXAP
• NCBI Protein Information: regulatory factor X-associated protein
• Protein Family: Regulatory factor X-associated protein

NCBI Description

Major histocompatibility (MHC) class II molecules are transmembrane proteins that have a central role in development and control of the immune system. The protein encoded by this gene, along with regulatory factor X-associated ankyrin-containing protein and regulatory factor-5, forms a complex that binds to the X box motif of certain MHC class II gene promoters and activates their transcription. Once bound to the promoter, this complex associates with the non-DNA-binding factor MHC class II transactivator, which controls the cell type specificity and inducibility of MHC class II gene expression. Mutations in this gene have been linked to bare lymphocyte syndrome type II, complementation group D. Transcript variants utilizing different polyA signals have been found for this gene. [provided by RefSeq, Jul 2008]