Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '26183'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
1.83 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '26183' and pd.language_id = 1
Query
Database
1.32 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26183'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
2.09 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '26183'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '26183' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26183'
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (70) "Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)"
$value['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value['app_notes']
⇄⧉testing_protocols => string (898) "Application Data||Detection limit for recombinant GST tagged STIP1 is approx...
$value['testing_protocols']
Application Data||Detection limit for recombinant GST tagged STIP1 is approximately 0.03ng/ml as a capture antibody.||AAA26183_APP6.jpg!!WB (Western Blot)||STIP1 monoclonal antibody (M11), clone 1E3 Western Blot analysis of STIP1 expression in HeLa.||AAA26183_WB5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26183_IF4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26183_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]||AAA26183_IHC2.jpg!!Application Data||Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]||AAA26183_APP.jpg
Immunogen||STIP1 (NP_006810.1, 445aa-543aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR!!Conjugate||Biotin
⇄⧉products_description => string (517) "STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSP...
$value['products_description']
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]). [supplied by OMIM]
⇄⧉products_references => string (209) "1. Glaucoma-associated WDR36 variants encode functional defects in a yeast m...
$value['products_references']
1. Glaucoma-associated WDR36 variants encode functional defects in a yeast model system. Footz TK, Johnson JL, Dubois S, Boivin N, Raymond V, Walter MA.Hum Mol Genet. 2009 Apr1;18(7):1276-87. Epub 2009 Jan 15.
⇄⧉products_related_diseases => string (235) "Inflammation||7!!Nervous System Diseases||7!!Brain Diseases||4!!Liver Diseas...
$value['products_related_diseases']
Inflammation||7!!Nervous System Diseases||7!!Brain Diseases||4!!Liver Diseases||4!!Disease Models, Animal||3!!Cardiovascular Diseases||3!!Central Nervous System Diseases||3!!Liver Neoplasms||2!!Carcinoma, Hepatocellular||2!!Necrosis||2
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value->a['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value->a['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value->a['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (70) "Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)"
$value->a['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value->a['app_notes']
⇄⧉testing_protocols => string (898) "Application Data||Detection limit for recombinant GST tagged STIP1 is approx...
$value->a['testing_protocols']
Application Data||Detection limit for recombinant GST tagged STIP1 is approximately 0.03ng/ml as a capture antibody.||AAA26183_APP6.jpg!!WB (Western Blot)||STIP1 monoclonal antibody (M11), clone 1E3 Western Blot analysis of STIP1 expression in HeLa.||AAA26183_WB5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26183_IF4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26183_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]||AAA26183_IHC2.jpg!!Application Data||Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]||AAA26183_APP.jpg
Immunogen||STIP1 (NP_006810.1, 445aa-543aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR!!Conjugate||Biotin
⇄⧉products_description => string (517) "STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSP...
$value->a['products_description']
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]). [supplied by OMIM]
⇄⧉products_references => string (209) "1. Glaucoma-associated WDR36 variants encode functional defects in a yeast m...
$value->a['products_references']
1. Glaucoma-associated WDR36 variants encode functional defects in a yeast model system. Footz TK, Johnson JL, Dubois S, Boivin N, Raymond V, Walter MA.Hum Mol Genet. 2009 Apr1;18(7):1276-87. Epub 2009 Jan 15.
⇄⧉products_related_diseases => string (235) "Inflammation||7!!Nervous System Diseases||7!!Brain Diseases||4!!Liver Diseas...
$value->a['products_related_diseases']
Inflammation||7!!Nervous System Diseases||7!!Brain Diseases||4!!Liver Diseases||4!!Disease Models, Animal||3!!Cardiovascular Diseases||3!!Central Nervous System Diseases||3!!Liver Neoplasms||2!!Carcinoma, Hepatocellular||2!!Necrosis||2
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value->d['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value->d['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value->d['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (70) "Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)"
$value->d['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value->d['app_notes']
⇄⧉testing_protocols => string (898) "Application Data||Detection limit for recombinant GST tagged STIP1 is approx...
$value->d['testing_protocols']
Application Data||Detection limit for recombinant GST tagged STIP1 is approximately 0.03ng/ml as a capture antibody.||AAA26183_APP6.jpg!!WB (Western Blot)||STIP1 monoclonal antibody (M11), clone 1E3 Western Blot analysis of STIP1 expression in HeLa.||AAA26183_WB5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26183_IF4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26183_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]||AAA26183_IHC2.jpg!!Application Data||Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]||AAA26183_APP.jpg
Immunogen||STIP1 (NP_006810.1, 445aa-543aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR!!Conjugate||Biotin
⇄⧉products_description => string (517) "STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSP...
$value->d['products_description']
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]). [supplied by OMIM]
⇄⧉products_references => string (209) "1. Glaucoma-associated WDR36 variants encode functional defects in a yeast m...
$value->d['products_references']
1. Glaucoma-associated WDR36 variants encode functional defects in a yeast model system. Footz TK, Johnson JL, Dubois S, Boivin N, Raymond V, Walter MA.Hum Mol Genet. 2009 Apr1;18(7):1276-87. Epub 2009 Jan 15.
⇄⧉products_related_diseases => string (235) "Inflammation||7!!Nervous System Diseases||7!!Brain Diseases||4!!Liver Diseas...
$value->d['products_related_diseases']
Inflammation||7!!Nervous System Diseases||7!!Brain Diseases||4!!Liver Diseases||4!!Disease Models, Animal||3!!Cardiovascular Diseases||3!!Central Nervous System Diseases||3!!Liver Neoplasms||2!!Carcinoma, Hepatocellular||2!!Necrosis||2
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value[0]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value[0]['_source']['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[0]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Flow Cytometry (FC/FACS), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[0]['_source']['app_notes']
⇄⧉testing_protocols => string (1091) "FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclo...
$value[0]['_source']['testing_protocols']
FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclonal antibody clone 2E1 (Green) and non-stained ES-2 cells (Black) as negative control.||AAA26672_FCM6.jpg!!FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclonal antibody clone 2E1 (Green) and non-stained ES-2 cells (Black) as negative control.||AAA26672_FCM5.jpg!!FCM (Flow Cytometry)||FACS analysis of 293 cells stained with STIP1 monoclonal antibody clone 2E1 (Green) and non-stained 293 cells (Black) as negative control.||AAA26672_FCM4.jpg!!FCM (Flow Cytometry)||FACS analysis of 293 cells stained with STIP1 monoclonal antibody clone 2E1 (Green) and non-stained 293 cells (Black) as negative control.||AAA26672_FCM3.jpg!!FCM (Flow Cytometry)||FACS analysis of HeLa cells stained with STIP1 monoclonal antibody clone 2E1 (Green) and non-stained HeLa cells (Black) as negative control.||AAA26672_FCM2.jpg!!FCM (Flow Cytometry)||FACS analysis of HeLa cells stained with STIP1 monoclonal antibody clone 2E1 (Green) and non-stained HeLa cells (Black) as negative control.||AAA26672_FCM.jpg
⇄⧉products_description => string (517) "STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSP...
$value[0]['_source']['products_description']
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]). [supplied by OMIM]
⇄⧉search_terms => string (720) "aaa26672 mouse monoclonal igg1,k 20 purified supplied as a liquid in pbs ph ...
$value[0]['_source']['search_terms']
aaa26672 mouse monoclonal igg1,k 20 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes stip1 flow cytometry fc facs immunofluorescence if immunohistochemistry ihc western blot wb applications are based on unconjugated antibody analysis of hela cells stained clone 2e1 green and non black negative control aaa26672_fc aaa26672_fc2 293 aaa26672_fc3 aaa26672_fc4 es 2 aaa26672_fc5 aaa26672_fc6 stress induced phosphoprotein 1 hop ief ssp 3521 p60 sti1 sti1l hel s 94n 12804257 aah02987.1 p31948 antibodies proteins immunogen 1aa 543aa full length recombinant protein gst tag mw the alone is 26kd conjugate igg1,k20 ph7.2 clone2e1 aaa26672_fc2293 es2 phosphoprotein1
⇄⧉form => string (107) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Flu...
$value[1]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
⇄concentration => string (3) "N/A"
$value[1]['_source']['concentration']
⇄⧉storage_stability => string (486) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[1]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.<br><br>FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Flow Cytometry (FC/FACS), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[1]['_source']['app_notes']
⇄⧉testing_protocols => string (1097) "FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclo...
$value[1]['_source']['testing_protocols']
FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained ES-2 cells (Black) as negative control.||AAA26408_FCM6.jpg!!FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained ES-2 cells (Black) as negative control.||AAA26408_FCM5.jpg!!FCM (Flow Cytometry)||FACS analysis of 293 cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained 293 cells (Black) as negative control.||AAA26408_FCM4.jpg!!FCM (Flow Cytometry)||FACS analysis of 293 cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained 293 cells (Black) as negative control.||AAA26408_FCM3.jpg!!FCM (Flow Cytometry)||FACS analysis of HeLa cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained HeLa cells (Black) as negative control.||AAA26408_FCM2.jpg!!FCM (Flow Cytometry)||FACS analysis of HeLa cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained HeLa cells (Black) as negative control.||AAA26408_FCM.jpg
⇄⧉products_description => string (517) "STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSP...
$value[1]['_source']['products_description']
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]). [supplied by OMIM]
⇄⧉products_references => string (856) "1. Immunohistological analysis of stress-induced phosphoprotein 1 in ovarian...
$value[1]['_source']['products_references']
1. Immunohistological analysis of stress-induced phosphoprotein 1 in ovarian cancer patients with low serum cancer antigen 125 levels. Chao A, Lee LY, Hsueh C, Lin CY, Tsai CL, Chao AS, Lin CT, Chou HH, Chang TC, Wang THTaiwan J Obstet Gynecol. 2013 Jun;52(2):185-91. doi: 10.1016/j.tjog.2013.04.006. 2. Tumor Stress-Induced Phosphoprotein1 (STIP1) as a Prognostic Biomarker in Ovarian Cancer. Chao A, Lai CH, Tsai CL, Hsueh S, Hsueh C, Lin CY, Chou HH, Lin YJ, Chen HW, Chang TC, Wang THPLoS One. 2013;8(2):e57084. doi: 10.1371/journal.pone.0057084. Epub 2013 Feb 27. 3. Stress-induced phosphoprotein 1 as a secreted biomarker for human ovarian cancer promotes cancer cell proliferation. Wang TH, Chao A, Tsai CL, Chang CL, Chen SH, Lee YS, Chen JK, Lin YJ, Chang PY, Wang CJ, Chao AS, Chang SD, Chang TC, Lai CH, Wang HS.Mol Cell Proteomics. 2010 May 25.
⇄⧉search_terms => string (721) "aaa26408 mouse monoclonal igg1,k 2.0e+11 purified supplied as a liquid in pb...
$value[1]['_source']['search_terms']
aaa26408 mouse monoclonal igg1,k 2.0e+11 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with fluorescein isothiocyanate fitc recognizes stip1 flow cytometry fc facs immunofluorescence if immunohistochemistry ihc western blot wb applications are based on unconjugated antibody analysis of hela cells stained clone 2e11 green and non black negative control aaa26408_fc aaa26408_fc2 293 aaa26408_fc3 aaa26408_fc4 es 2 aaa26408_fc5 aaa26408_fc6 stress induced phosphoprotein 1 hop ief ssp 3521 p60 sti1 sti1l hel s 94n 12804257 aah02987.1 p31948 antibodies proteins immunogen 1aa 543aa full length recombinant protein gst tag mw the alone is 26kd conjugate ph7.2 aaa26408_fc2293 es2 phosphoprotein1
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value[2]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value[2]['_source']['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[2]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (55) "ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)"
$value[2]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[2]['_source']['app_notes']
⇄⧉testing_protocols => string (815) "Application Data||Detection limit for recombinant GST tagged STIP1 is 0.03 n...
$value[2]['_source']['testing_protocols']
Application Data||Detection limit for recombinant GST tagged STIP1 is 0.03 ng/ml as a capture antibody.||AAA26679_APP6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26679_IF5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26679_IF4.jpg!!WB (Western Blot)||STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in NIH/3T3.||AAA26679_WB3.jpg!!WB (Western Blot)||STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in PC-12.||AAA26679_WB2.jpg!!WB (Western Blot)||STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in Raw 264.7.||AAA26679_WB.jpg
Immunogen||STIP1 (NP_006810.1, 445aa-543aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR!!Conjugate||PE
1. Secreted Stress-Induced Phosphoprotein 1 Activates the ALK2-SMAD Signaling Pathways and Promotes Cell Proliferation of Ovarian Cancer Cells. Tsai CL, Tsai CN, Lin CY, Chen HW, Lee YS, Chao A, Wang TH, Wang HS, Lai CH.Cell Rep. 2012 Aug 30;2(2):283-93. Epub 2012 Aug 9.
⇄⧉products_related_diseases => string (235) "Inflammation||7!!Nervous System Diseases||7!!Brain Diseases||4!!Liver Diseas...
$value[2]['_source']['products_related_diseases']
Inflammation||7!!Nervous System Diseases||7!!Brain Diseases||4!!Liver Diseases||4!!Disease Models, Animal||3!!Cardiovascular Diseases||3!!Central Nervous System Diseases||3!!Liver Neoplasms||2!!Carcinoma, Hepatocellular||2!!Necrosis||2
⇄⧉search_terms => string (1054) "aaa26679 mouse monoclonal igg2a,k 1c6 purified supplied as a liquid in pbs p...
$value[2]['_source']['search_terms']
aaa26679 mouse monoclonal igg2a,k 1c6 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes stip1 elisa eia immunofluorescence if western blot wb applications are based on unconjugated antibody m06 clone analysis of expression raw 264.7 aaa26679_wb pc 12 aaa26679_wb2 nih 3t3 aaa26679_wb3 to hela cell concentration 10 ug ml aaa26679_if4 aaa26679_if5 testing data detection limit for recombinant gst tagged is 0.03 ng capture aaa26679_td6 stress induced phosphoprotein 1 hop ief ssp 3521 p60 sti1 sti1l isoform b hel s 94n ny ren 11 antigen hsp70 hsp90 organizing protein hsc70 renal carcinoma transformation sensitive epididymis secretory sperm binding li 62,639 da stip1_human 5803181 np_006810.1 p31948 nm_006819.2 q3zcu9 q5tzu9 b4dm70 f5h0t1 g3xad8 605063 antibodies proteins immunogen 445aa 543aa partial tag mw the alone 26kd sequence tkamdvyqkaldldssckeaadgyqrcmmaqynrhdspedvkrramadpevqqimsdpamrlileqmqkdpqalsehlknpviaqkiqklmdvgliair conjugate ph7.2 pc12 concentration10 phosphoprotein1 ren11
⇄specificity => string (23) "Recognizes human STIP1."
$value[3]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[3]['_source']['purity']
⇄⧉form => string (107) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Flu...
$value[3]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
⇄concentration => string (3) "N/A"
$value[3]['_source']['concentration']
⇄⧉storage_stability => string (488) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[3]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value[3]['_source']['app_notes']
⇄⧉testing_protocols => string (1049) "WB (Western Blot)||Western Blot detection against Immunogen (85.84kD).||AAA2...
$value[3]['_source']['testing_protocols']
WB (Western Blot)||Western Blot detection against Immunogen (85.84kD).||AAA25265_WB7.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (85.84kD).||AAA25265_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged STIP1 is ~0.1ng/ml as a capture antibody.||AAA25265_APP5.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of STIP1 transfected lysate using STIP1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with STIP1 rabbit polyclonal antibody.||AAA25265_IP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10ug/ml].||AAA25265_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.3ug/ml].||AAA25265_IHC2.jpg!!WB (Western Blot)||Western Blot analysis of STIP1 expression in transfected 293T cell line by STIP1 monoclonal antibody Lane 1: STIP1 transfected lysate (62.6kD). Lane 2: Non-transfected lysate.||AAA25265_WB.jpg
⇄⧉etc_term1 => string (716) "Immunogen||Full length recombinant corresponding to aa1-544 from human STIP1...
$value[3]['_source']['etc_term1']
Immunogen||Full length recombinant corresponding to aa1-544 from human STIP1 (AAH02987) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR!!Conjugate||FITC
⇄⧉products_related_diseases => string (200) "Neoplasms||12!!Nervous System Diseases||5!!Immune System Diseases||5!!Inflam...
$value[3]['_source']['products_related_diseases']
Neoplasms||12!!Nervous System Diseases||5!!Immune System Diseases||5!!Inflammation||3!!Disease Models, Animal||3!!Brain Diseases||2!!Drug Toxicity||2!!Necrosis||2!!Hypertension||1!!Memory Disorders||1
⇄⧉search_terms => string (1717) "aaa25265 mouse human monoclonal igg2a,k 4b6 purified by protein a affinity c...
$value[3]['_source']['search_terms']
aaa25265 mouse human monoclonal igg2a,k 4b6 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with fluorescein isothiocyanate fitc recognizes stip1 elisa eia immunofluorescence if immunohistochemistry ihc immunoprecipitation ip western blot wb 10ug ml applications are based on unconjugated antibody analysis of expression transfected 293t cell line lane 1 lysate 62.6kd 2 non aaa25265_wb immunoperoxidase to formalin fixed paraffin embedded testis concentration 0.3ug aaa25265_ihc2 hela aaa25265_if3 using and magnetic bead immunoblotted rabbit polyclonal aaa25265_ip4 testing data detection limit for recombinant gst tagged is ~0.1ng capture aaa25265_td5 against immunogen 85.84kd aaa25265_wb6 aaa25265_wb7 stress induced phosphoprotein sti1 hsc70 hsp90 organizing hop p60 renal carcinoma antigen ny ren 11 sti1l transformation sensitive ief ssp 3521 homo sapiens mrna hel s 94n 59,778 da 12804256 bc002987 aah02987.1 p31948 q3zcu9 q5tzu9 b4dm70 f5h0t1 g3xad8 antibodies heat shock proteins full length corresponding aa1 544 from aah02987 tag mw the alone 26kd sequence meqvnelkekgnkalsvgniddalqcyseaikldphnhvlysnrsaayakkgdyqkayedgcktvdlkpdwgkgysrkaaaleflnrfeeakrtyeeglkheannpqlkeglqnmearlaerkfmnpfnmpnlyqklesdprtrtllsdptyrelieqlrnkpsdlgtklqdprimttlsvllgvdlgsmdeeeeiatpppppppkketkpepmeedlpenkkqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcrelcekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkcqqaekilkeqerlayinpdlaleeknkgnecfqkgdypqamkhyteaikrnpkdaklysnraacytkllefqlalkdceeciqleptfikgytrkaaaleamkdytkamdvyqkaldldssckeaadgyqrcmmaqynrhdspedvkrramadpevqqimsdpamrlileqmqkdpqalsehlknpviaqkiqklmdvgliair conjugate ph7.2 lane1 62.6kd2 ren11 aa1544
⇄⧉form => string (95) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with All...
$value[4]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
⇄concentration => string (3) "N/A"
$value[4]['_source']['concentration']
⇄⧉storage_stability => string (364) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[4]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (70) "Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)"
$value[4]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[4]['_source']['app_notes']
⇄⧉testing_protocols => string (898) "Application Data||Detection limit for recombinant GST tagged STIP1 is approx...
$value[4]['_source']['testing_protocols']
Application Data||Detection limit for recombinant GST tagged STIP1 is approximately 0.03ng/ml as a capture antibody.||AAA26050_APP6.jpg!!WB (Western Blot)||STIP1 monoclonal antibody (M11), clone 1E3 Western Blot analysis of STIP1 expression in HeLa.||AAA26050_WB5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26050_IF4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26050_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]||AAA26050_IHC2.jpg!!Application Data||Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]||AAA26050_APP.jpg
Immunogen||STIP1 (NP_006810.1, 445aa-543aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR!!Conjugate||APC
⇄⧉products_description => string (517) "STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSP...
$value[4]['_source']['products_description']
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]). [supplied by OMIM]
⇄⧉products_references => string (209) "1. Glaucoma-associated WDR36 variants encode functional defects in a yeast m...
$value[4]['_source']['products_references']
1. Glaucoma-associated WDR36 variants encode functional defects in a yeast model system. Footz TK, Johnson JL, Dubois S, Boivin N, Raymond V, Walter MA.Hum Mol Genet. 2009 Apr1;18(7):1276-87. Epub 2009 Jan 15.
⇄⧉products_related_diseases => string (235) "Inflammation||7!!Nervous System Diseases||7!!Brain Diseases||4!!Liver Diseas...
$value[4]['_source']['products_related_diseases']
Inflammation||7!!Nervous System Diseases||7!!Brain Diseases||4!!Liver Diseases||4!!Disease Models, Animal||3!!Cardiovascular Diseases||3!!Central Nervous System Diseases||3!!Liver Neoplasms||2!!Carcinoma, Hepatocellular||2!!Necrosis||2
⇄⧉search_terms => string (1138) "aaa26050 mouse monoclonal igg2a,k 1000 purified supplied as a liquid in pbs ...
$value[4]['_source']['search_terms']
aaa26050 mouse monoclonal igg2a,k 1000 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with allophycocyanin apc recognizes stip1 immunofluorescence if immunohistochemistry ihc western blot wb applications are based on unconjugated antibody testing data immunoperoxidase of to formalin fixed paraffin embedded human lung concentration 3 ug ml aaa26050_td aaa26050_ihc2 hela cell 10 aaa26050_if3 aaa26050_if4 m11 clone 1e3 analysis expression aaa26050_wb5 detection limit for recombinant gst tagged is approximately 0.03ng capture aaa26050_td6 stress induced phosphoprotein 1 hop ief ssp 3521 p60 sti1 sti1l isoform b hel s 94n ny ren 11 antigen hsp70 hsp90 organizing protein hsc70 renal carcinoma transformation sensitive epididymis secretory sperm binding li 62,639 da stip1_human 5803181 np_006810.1 p31948 nm_006819.2 q3zcu9 q5tzu9 b4dm70 f5h0t1 g3xad8 605063 antibodies proteins immunogen 445aa 543aa partial tag mw the alone 26kd sequence tkamdvyqkaldldssckeaadgyqrcmmaqynrhdspedvkrramadpevqqimsdpamrlileqmqkdpqalsehlknpviaqkiqklmdvgliair conjugate ph7.2 concentration3 cell10 clone1e3 phosphoprotein1 ren11
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value[5]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value[5]['_source']['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[5]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (70) "Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)"
$value[5]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[5]['_source']['app_notes']
⇄⧉testing_protocols => string (898) "Application Data||Detection limit for recombinant GST tagged STIP1 is approx...
$value[5]['_source']['testing_protocols']
Application Data||Detection limit for recombinant GST tagged STIP1 is approximately 0.03ng/ml as a capture antibody.||AAA26183_APP6.jpg!!WB (Western Blot)||STIP1 monoclonal antibody (M11), clone 1E3 Western Blot analysis of STIP1 expression in HeLa.||AAA26183_WB5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26183_IF4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26183_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]||AAA26183_IHC2.jpg!!Application Data||Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]||AAA26183_APP.jpg
Immunogen||STIP1 (NP_006810.1, 445aa-543aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR!!Conjugate||Biotin
⇄⧉products_description => string (517) "STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSP...
$value[5]['_source']['products_description']
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]). [supplied by OMIM]
⇄⧉products_references => string (209) "1. Glaucoma-associated WDR36 variants encode functional defects in a yeast m...
$value[5]['_source']['products_references']
1. Glaucoma-associated WDR36 variants encode functional defects in a yeast model system. Footz TK, Johnson JL, Dubois S, Boivin N, Raymond V, Walter MA.Hum Mol Genet. 2009 Apr1;18(7):1276-87. Epub 2009 Jan 15.
⇄⧉products_related_diseases => string (235) "Inflammation||7!!Nervous System Diseases||7!!Brain Diseases||4!!Liver Diseas...
$value[5]['_source']['products_related_diseases']
Inflammation||7!!Nervous System Diseases||7!!Brain Diseases||4!!Liver Diseases||4!!Disease Models, Animal||3!!Cardiovascular Diseases||3!!Central Nervous System Diseases||3!!Liver Neoplasms||2!!Carcinoma, Hepatocellular||2!!Necrosis||2
⇄⧉search_terms => string (1125) "aaa26183 mouse monoclonal igg2a,k 1000 purified supplied as a liquid in pbs ...
$value[5]['_source']['search_terms']
aaa26183 mouse monoclonal igg2a,k 1000 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes stip1 immunofluorescence if immunohistochemistry ihc western blot wb applications are based on unconjugated antibody testing data immunoperoxidase of to formalin fixed paraffin embedded human lung concentration 3 ug ml aaa26183_td aaa26183_ihc2 hela cell 10 aaa26183_if3 aaa26183_if4 m11 clone 1e3 analysis expression aaa26183_wb5 detection limit for recombinant gst tagged is approximately 0.03ng capture aaa26183_td6 stress induced phosphoprotein 1 hop ief ssp 3521 p60 sti1 sti1l isoform b hel s 94n ny ren 11 antigen hsp70 hsp90 organizing protein hsc70 renal carcinoma transformation sensitive epididymis secretory sperm binding li 62,639 da stip1_human 5803181 np_006810.1 p31948 nm_006819.2 q3zcu9 q5tzu9 b4dm70 f5h0t1 g3xad8 605063 antibodies proteins immunogen 445aa 543aa partial tag mw the alone 26kd sequence tkamdvyqkaldldssckeaadgyqrcmmaqynrhdspedvkrramadpevqqimsdpamrlileqmqkdpqalsehlknpviaqkiqklmdvgliair conjugate ph7.2 concentration3 cell10 clone1e3 phosphoprotein1 ren11
⇄⧉form => string (102) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with hor...
$value[6]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
⇄concentration => string (3) "N/A"
$value[6]['_source']['concentration']
⇄⧉storage_stability => string (537) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[6]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (70) "Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)"
$value[6]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[6]['_source']['app_notes']
⇄⧉testing_protocols => string (913) "Application Data||Detection limit for recombinant GST tagged STIP1 is approx...
$value[6]['_source']['testing_protocols']
Application Data||Detection limit for recombinant GST tagged STIP1 is approximately 0.03ng/ml as a capture antibody.||AAA26449_APP6.jpg!!WB (Western Blot)||STIP1 monoclonal antibody (M11), clone 1E3 Western Blot analysis of STIP1 expression in HeLa (Cat # L013V1).||AAA26449_WB5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26449_IF4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26449_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]||AAA26449_IHC2.jpg!!Application Data||Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]||AAA26449_APP.jpg
Immunogen||STIP1 (NP_006810.1, 445aa-543aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR!!Conjugate||HRP
⇄⧉products_references => string (209) "1. Glaucoma-associated WDR36 variants encode functional defects in a yeast m...
$value[6]['_source']['products_references']
1. Glaucoma-associated WDR36 variants encode functional defects in a yeast model system. Footz TK, Johnson JL, Dubois S, Boivin N, Raymond V, Walter MA.Hum Mol Genet. 2009 Apr1;18(7):1276-87. Epub 2009 Jan 15.
⇄⧉products_related_diseases => string (235) "Inflammation||7!!Nervous System Diseases||7!!Brain Diseases||4!!Liver Diseas...
$value[6]['_source']['products_related_diseases']
Inflammation||7!!Nervous System Diseases||7!!Brain Diseases||4!!Liver Diseases||4!!Disease Models, Animal||3!!Cardiovascular Diseases||3!!Central Nervous System Diseases||3!!Liver Neoplasms||2!!Carcinoma, Hepatocellular||2!!Necrosis||2
⇄⧉search_terms => string (1158) "aaa26449 mouse monoclonal igg2a,k 1000 purified supplied as a liquid in pbs ...
$value[6]['_source']['search_terms']
aaa26449 mouse monoclonal igg2a,k 1000 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes stip1 immunofluorescence if immunohistochemistry ihc western blot wb applications are based on unconjugated antibody testing data immunoperoxidase of to formalin fixed paraffin embedded human lung concentration 3 ug ml aaa26449_td aaa26449_ihc2 hela cell 10 aaa26449_if3 aaa26449_if4 m11 clone 1e3 analysis expression cat # l013v1 aaa26449_wb5 detection limit for recombinant gst tagged is approximately 0.03ng capture aaa26449_td6 stress induced phosphoprotein 1 hop ief ssp 3521 p60 sti1 sti1l isoform b hel s 94n ny ren 11 antigen hsp70 hsp90 organizing protein hsc70 renal carcinoma transformation sensitive epididymis secretory sperm binding li 62,639 da stip1_human 5803181 np_006810.1 p31948 nm_006819.2 q3zcu9 q5tzu9 b4dm70 f5h0t1 g3xad8 605063 antibodies proteins immunogen 445aa 543aa partial tag mw the alone 26kd sequence tkamdvyqkaldldssckeaadgyqrcmmaqynrhdspedvkrramadpevqqimsdpamrlileqmqkdpqalsehlknpviaqkiqklmdvgliair conjugate ph7.2 concentration3 cell10 clone1e3 phosphoprotein1 ren11
⇄specificity => string (23) "Recognizes human STIP1."
$value[7]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[7]['_source']['purity']
⇄⧉form => string (95) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with All...
$value[7]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
⇄concentration => string (3) "N/A"
$value[7]['_source']['concentration']
⇄⧉storage_stability => string (364) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[7]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value[7]['_source']['app_notes']
⇄⧉testing_protocols => string (1049) "WB (Western Blot)||Western Blot detection against Immunogen (85.84kD).||AAA2...
$value[7]['_source']['testing_protocols']
WB (Western Blot)||Western Blot detection against Immunogen (85.84kD).||AAA24673_WB7.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (85.84kD).||AAA24673_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged STIP1 is ~0.1ng/ml as a capture antibody.||AAA24673_APP5.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of STIP1 transfected lysate using STIP1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with STIP1 rabbit polyclonal antibody.||AAA24673_IP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10ug/ml].||AAA24673_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.3ug/ml].||AAA24673_IHC2.jpg!!WB (Western Blot)||Western Blot analysis of STIP1 expression in transfected 293T cell line by STIP1 monoclonal antibody Lane 1: STIP1 transfected lysate (62.6kD). Lane 2: Non-transfected lysate.||AAA24673_WB.jpg
⇄⧉etc_term1 => string (715) "Immunogen||Full length recombinant corresponding to aa1-544 from human STIP1...
$value[7]['_source']['etc_term1']
Immunogen||Full length recombinant corresponding to aa1-544 from human STIP1 (AAH02987) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR!!Conjugate||APC
⇄⧉products_related_diseases => string (200) "Neoplasms||12!!Nervous System Diseases||5!!Immune System Diseases||5!!Inflam...
$value[7]['_source']['products_related_diseases']
Neoplasms||12!!Nervous System Diseases||5!!Immune System Diseases||5!!Inflammation||3!!Disease Models, Animal||3!!Brain Diseases||2!!Drug Toxicity||2!!Necrosis||2!!Hypertension||1!!Memory Disorders||1
⇄⧉search_terms => string (1705) "aaa24673 mouse human monoclonal igg2a,k 4b6 purified by protein a affinity c...
$value[7]['_source']['search_terms']
aaa24673 mouse human monoclonal igg2a,k 4b6 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with allophycocyanin apc recognizes stip1 elisa eia immunofluorescence if immunohistochemistry ihc immunoprecipitation ip western blot wb 10ug ml applications are based on unconjugated antibody analysis of expression transfected 293t cell line lane 1 lysate 62.6kd 2 non aaa24673_wb immunoperoxidase to formalin fixed paraffin embedded testis concentration 0.3ug aaa24673_ihc2 hela aaa24673_if3 using and magnetic bead immunoblotted rabbit polyclonal aaa24673_ip4 testing data detection limit for recombinant gst tagged is ~0.1ng capture aaa24673_td5 against immunogen 85.84kd aaa24673_wb6 aaa24673_wb7 stress induced phosphoprotein sti1 hsc70 hsp90 organizing hop p60 renal carcinoma antigen ny ren 11 sti1l transformation sensitive ief ssp 3521 homo sapiens mrna hel s 94n 59,778 da 12804256 bc002987 aah02987.1 p31948 q3zcu9 q5tzu9 b4dm70 f5h0t1 g3xad8 antibodies heat shock proteins full length corresponding aa1 544 from aah02987 tag mw the alone 26kd sequence meqvnelkekgnkalsvgniddalqcyseaikldphnhvlysnrsaayakkgdyqkayedgcktvdlkpdwgkgysrkaaaleflnrfeeakrtyeeglkheannpqlkeglqnmearlaerkfmnpfnmpnlyqklesdprtrtllsdptyrelieqlrnkpsdlgtklqdprimttlsvllgvdlgsmdeeeeiatpppppppkketkpepmeedlpenkkqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcrelcekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkcqqaekilkeqerlayinpdlaleeknkgnecfqkgdypqamkhyteaikrnpkdaklysnraacytkllefqlalkdceeciqleptfikgytrkaaaleamkdytkamdvyqkaldldssckeaadgyqrcmmaqynrhdspedvkrramadpevqqimsdpamrlileqmqkdpqalsehlknpviaqkiqklmdvgliair conjugate ph7.2 lane1 62.6kd2 ren11 aa1544
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value[8]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value[8]['_source']['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[8]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (70) "Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)"
$value[8]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[8]['_source']['app_notes']
⇄⧉testing_protocols => string (913) "Application Data||Detection limit for recombinant GST tagged STIP1 is approx...
$value[8]['_source']['testing_protocols']
Application Data||Detection limit for recombinant GST tagged STIP1 is approximately 0.03ng/ml as a capture antibody.||AAA26582_APP6.jpg!!WB (Western Blot)||STIP1 monoclonal antibody (M11), clone 1E3 Western Blot analysis of STIP1 expression in HeLa (Cat # L013V1).||AAA26582_WB5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26582_IF4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26582_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]||AAA26582_IHC2.jpg!!Application Data||Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]||AAA26582_APP.jpg
Immunogen||STIP1 (NP_006810.1, 445aa-543aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR!!Conjugate||PE
⇄⧉products_description => string (517) "STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSP...
$value[8]['_source']['products_description']
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]). [supplied by OMIM]
⇄⧉products_references => string (209) "1. Glaucoma-associated WDR36 variants encode functional defects in a yeast m...
$value[8]['_source']['products_references']
1. Glaucoma-associated WDR36 variants encode functional defects in a yeast model system. Footz TK, Johnson JL, Dubois S, Boivin N, Raymond V, Walter MA.Hum Mol Genet. 2009 Apr1;18(7):1276-87. Epub 2009 Jan 15.
⇄⧉products_related_diseases => string (235) "Inflammation||7!!Nervous System Diseases||7!!Brain Diseases||4!!Liver Diseas...
$value[8]['_source']['products_related_diseases']
Inflammation||7!!Nervous System Diseases||7!!Brain Diseases||4!!Liver Diseases||4!!Disease Models, Animal||3!!Cardiovascular Diseases||3!!Central Nervous System Diseases||3!!Liver Neoplasms||2!!Carcinoma, Hepatocellular||2!!Necrosis||2
⇄⧉search_terms => string (1150) "aaa26582 mouse monoclonal igg2a,k 1000 purified supplied as a liquid in pbs ...
$value[8]['_source']['search_terms']
aaa26582 mouse monoclonal igg2a,k 1000 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes stip1 immunofluorescence if immunohistochemistry ihc western blot wb applications are based on unconjugated antibody testing data immunoperoxidase of to formalin fixed paraffin embedded human lung concentration 3 ug ml aaa26582_td aaa26582_ihc2 hela cell 10 aaa26582_if3 aaa26582_if4 m11 clone 1e3 analysis expression cat # l013v1 aaa26582_wb5 detection limit for recombinant gst tagged is approximately 0.03ng capture aaa26582_td6 stress induced phosphoprotein 1 hop ief ssp 3521 p60 sti1 sti1l isoform b hel s 94n ny ren 11 antigen hsp70 hsp90 organizing protein hsc70 renal carcinoma transformation sensitive epididymis secretory sperm binding li 62,639 da stip1_human 5803181 np_006810.1 p31948 nm_006819.2 q3zcu9 q5tzu9 b4dm70 f5h0t1 g3xad8 605063 antibodies proteins immunogen 445aa 543aa partial tag mw the alone 26kd sequence tkamdvyqkaldldssckeaadgyqrcmmaqynrhdspedvkrramadpevqqimsdpamrlileqmqkdpqalsehlknpviaqkiqklmdvgliair conjugate ph7.2 concentration3 cell10 clone1e3 phosphoprotein1 ren11
⇄specificity => string (23) "Recognizes human STIP1."
$value[9]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[9]['_source']['purity']
⇄⧉form => string (102) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with hor...
$value[9]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
⇄concentration => string (3) "N/A"
$value[9]['_source']['concentration']
⇄⧉storage_stability => string (537) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[9]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
⇄app_notes => string (67) "IHC-P: 0.3ug/ml<br>Applications are based on unconjugated antibody."
$value[9]['_source']['app_notes']
⇄⧉testing_protocols => string (1049) "WB (Western Blot)||Western Blot detection against Immunogen (85.84kD).||AAA2...
$value[9]['_source']['testing_protocols']
WB (Western Blot)||Western Blot detection against Immunogen (85.84kD).||AAA25559_WB7.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (85.84kD).||AAA25559_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged STIP1 is ~0.1ng/ml as a capture antibody.||AAA25559_APP5.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of STIP1 transfected lysate using STIP1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with STIP1 rabbit polyclonal antibody.||AAA25559_IP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10ug/ml].||AAA25559_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.3ug/ml].||AAA25559_IHC2.jpg!!WB (Western Blot)||Western Blot analysis of STIP1 expression in transfected 293T cell line by STIP1 monoclonal antibody Lane 1: STIP1 transfected lysate (62.6kD). Lane 2: Non-transfected lysate.||AAA25559_WB.jpg
⇄⧉etc_term1 => string (715) "Immunogen||Full length recombinant corresponding to aa1-544 from human STIP1...
$value[9]['_source']['etc_term1']
Immunogen||Full length recombinant corresponding to aa1-544 from human STIP1 (AAH02987) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR!!Conjugate||HRP
⇄⧉products_related_diseases => string (200) "Neoplasms||12!!Nervous System Diseases||5!!Immune System Diseases||5!!Inflam...
$value[9]['_source']['products_related_diseases']
Neoplasms||12!!Nervous System Diseases||5!!Immune System Diseases||5!!Inflammation||3!!Disease Models, Animal||3!!Brain Diseases||2!!Drug Toxicity||2!!Necrosis||2!!Hypertension||1!!Memory Disorders||1
⇄⧉search_terms => string (1714) "aaa25559 mouse human monoclonal igg2a,k 4b6 purified by protein a affinity c...
$value[9]['_source']['search_terms']
aaa25559 mouse human monoclonal igg2a,k 4b6 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes stip1 elisa eia immunohistochemistry ihc paraffin immunoprecipitation ip western blot wb p 0.3ug ml applications are based on unconjugated antibody analysis of expression transfected 293t cell line lane 1 lysate 62.6kd 2 non aaa25559_wb immunoperoxidase to formalin fixed embedded testis concentration aaa25559_ihc2 immunofluorescence if hela 10ug aaa25559_if3 using and magnetic bead immunoblotted rabbit polyclonal aaa25559_ip4 testing data detection limit for recombinant gst tagged is ~0.1ng capture aaa25559_td5 against immunogen 85.84kd aaa25559_wb6 aaa25559_wb7 stress induced phosphoprotein sti1 hsc70 hsp90 organizing hop p60 renal carcinoma antigen ny ren 11 sti1l transformation sensitive ief ssp 3521 homo sapiens mrna hel s 94n 59,778 da 12804256 bc002987 aah02987.1 p31948 q3zcu9 q5tzu9 b4dm70 f5h0t1 g3xad8 antibodies heat shock proteins full length corresponding aa1 544 from aah02987 tag mw the alone 26kd sequence meqvnelkekgnkalsvgniddalqcyseaikldphnhvlysnrsaayakkgdyqkayedgcktvdlkpdwgkgysrkaaaleflnrfeeakrtyeeglkheannpqlkeglqnmearlaerkfmnpfnmpnlyqklesdprtrtllsdptyrelieqlrnkpsdlgtklqdprimttlsvllgvdlgsmdeeeeiatpppppppkketkpepmeedlpenkkqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcrelcekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkcqqaekilkeqerlayinpdlaleeknkgnecfqkgdypqamkhyteaikrnpkdaklysnraacytkllefqlalkdceeciqleptfikgytrkaaaleamkdytkamdvyqkaldldssckeaadgyqrcmmaqynrhdspedvkrramadpevqqimsdpamrlileqmqkdpqalsehlknpviaqkiqklmdvgliair conjugate ph7.2 lane1 62.6kd2 ren11 aa1544
⇄⧉form => string (95) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with All...
$value[10]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
⇄concentration => string (3) "N/A"
$value[10]['_source']['concentration']
⇄⧉storage_stability => string (364) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[10]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Flow Cytometry (FC/FACS), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[10]['_source']['app_notes']
⇄⧉testing_protocols => string (1091) "FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclo...
$value[10]['_source']['testing_protocols']
FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclonal antibody clone 2E1 (Green) and non-stained ES-2 cells (Black) as negative control.||AAA26141_FCM6.jpg!!FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclonal antibody clone 2E1 (Green) and non-stained ES-2 cells (Black) as negative control.||AAA26141_FCM5.jpg!!FCM (Flow Cytometry)||FACS analysis of 293 cells stained with STIP1 monoclonal antibody clone 2E1 (Green) and non-stained 293 cells (Black) as negative control.||AAA26141_FCM4.jpg!!FCM (Flow Cytometry)||FACS analysis of 293 cells stained with STIP1 monoclonal antibody clone 2E1 (Green) and non-stained 293 cells (Black) as negative control.||AAA26141_FCM3.jpg!!FCM (Flow Cytometry)||FACS analysis of HeLa cells stained with STIP1 monoclonal antibody clone 2E1 (Green) and non-stained HeLa cells (Black) as negative control.||AAA26141_FCM2.jpg!!FCM (Flow Cytometry)||FACS analysis of HeLa cells stained with STIP1 monoclonal antibody clone 2E1 (Green) and non-stained HeLa cells (Black) as negative control.||AAA26141_FCM.jpg
⇄⧉products_description => string (517) "STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSP...
$value[10]['_source']['products_description']
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]). [supplied by OMIM]
⇄⧉search_terms => string (721) "aaa26141 mouse monoclonal igg1,k 20 purified supplied as a liquid in pbs ph ...
$value[10]['_source']['search_terms']
aaa26141 mouse monoclonal igg1,k 20 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with allophycocyanin apc recognizes stip1 flow cytometry fc facs immunofluorescence if immunohistochemistry ihc western blot wb applications are based on unconjugated antibody analysis of hela cells stained clone 2e1 green and non black negative control aaa26141_fc aaa26141_fc2 293 aaa26141_fc3 aaa26141_fc4 es 2 aaa26141_fc5 aaa26141_fc6 stress induced phosphoprotein 1 hop ief ssp 3521 p60 sti1 sti1l hel s 94n 12804257 aah02987.1 p31948 antibodies proteins immunogen 1aa 543aa full length recombinant protein gst tag mw the alone is 26kd conjugate igg1,k20 ph7.2 clone2e1 aaa26141_fc2293 es2 phosphoprotein1
⇄⧉form => string (95) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with All...
$value[11]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
⇄concentration => string (3) "N/A"
$value[11]['_source']['concentration']
⇄⧉storage_stability => string (364) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[11]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (55) "ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)"
$value[11]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[11]['_source']['app_notes']
⇄⧉testing_protocols => string (815) "Application Data||Detection limit for recombinant GST tagged STIP1 is 0.03 n...
$value[11]['_source']['testing_protocols']
Application Data||Detection limit for recombinant GST tagged STIP1 is 0.03 ng/ml as a capture antibody.||AAA26148_APP6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26148_IF5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26148_IF4.jpg!!WB (Western Blot)||STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in NIH/3T3.||AAA26148_WB3.jpg!!WB (Western Blot)||STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in PC-12.||AAA26148_WB2.jpg!!WB (Western Blot)||STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in Raw 264.7.||AAA26148_WB.jpg
Immunogen||STIP1 (NP_006810.1, 445aa-543aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR!!Conjugate||APC
1. Secreted Stress-Induced Phosphoprotein 1 Activates the ALK2-SMAD Signaling Pathways and Promotes Cell Proliferation of Ovarian Cancer Cells. Tsai CL, Tsai CN, Lin CY, Chen HW, Lee YS, Chao A, Wang TH, Wang HS, Lai CH.Cell Rep. 2012 Aug 30;2(2):283-93. Epub 2012 Aug 9.
⇄⧉products_related_diseases => string (235) "Inflammation||7!!Nervous System Diseases||7!!Brain Diseases||4!!Liver Diseas...
⇄⧉search_terms => string (1055) "aaa26148 mouse monoclonal igg2a,k 1c6 purified supplied as a liquid in pbs p...
$value[11]['_source']['search_terms']
aaa26148 mouse monoclonal igg2a,k 1c6 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with allophycocyanin apc recognizes stip1 elisa eia immunofluorescence if western blot wb applications are based on unconjugated antibody m06 clone analysis of expression raw 264.7 aaa26148_wb pc 12 aaa26148_wb2 nih 3t3 aaa26148_wb3 to hela cell concentration 10 ug ml aaa26148_if4 aaa26148_if5 testing data detection limit for recombinant gst tagged is 0.03 ng capture aaa26148_td6 stress induced phosphoprotein 1 hop ief ssp 3521 p60 sti1 sti1l isoform b hel s 94n ny ren 11 antigen hsp70 hsp90 organizing protein hsc70 renal carcinoma transformation sensitive epididymis secretory sperm binding li 62,639 da stip1_human 5803181 np_006810.1 p31948 nm_006819.2 q3zcu9 q5tzu9 b4dm70 f5h0t1 g3xad8 605063 antibodies proteins immunogen 445aa 543aa partial tag mw the alone 26kd sequence tkamdvyqkaldldssckeaadgyqrcmmaqynrhdspedvkrramadpevqqimsdpamrlileqmqkdpqalsehlknpviaqkiqklmdvgliair conjugate ph7.2 pc12 concentration10 phosphoprotein1 ren11
⇄specificity => string (23) "Recognizes human STIP1."
$value[12]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[12]['_source']['purity']
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value[12]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value[12]['_source']['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[12]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value[12]['_source']['app_notes']
⇄⧉testing_protocols => string (1049) "WB (Western Blot)||Western Blot detection against Immunogen (85.84kD).||AAA2...
$value[12]['_source']['testing_protocols']
WB (Western Blot)||Western Blot detection against Immunogen (85.84kD).||AAA24969_WB7.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (85.84kD).||AAA24969_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged STIP1 is ~0.1ng/ml as a capture antibody.||AAA24969_APP5.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of STIP1 transfected lysate using STIP1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with STIP1 rabbit polyclonal antibody.||AAA24969_IP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10ug/ml].||AAA24969_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.3ug/ml].||AAA24969_IHC2.jpg!!WB (Western Blot)||Western Blot analysis of STIP1 expression in transfected 293T cell line by STIP1 monoclonal antibody Lane 1: STIP1 transfected lysate (62.6kD). Lane 2: Non-transfected lysate.||AAA24969_WB.jpg
⇄⧉etc_term1 => string (718) "Immunogen||Full length recombinant corresponding to aa1-544 from human STIP1...
$value[12]['_source']['etc_term1']
Immunogen||Full length recombinant corresponding to aa1-544 from human STIP1 (AAH02987) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR!!Conjugate||Biotin
Neoplasms||12!!Nervous System Diseases||5!!Immune System Diseases||5!!Inflammation||3!!Disease Models, Animal||3!!Brain Diseases||2!!Drug Toxicity||2!!Necrosis||2!!Hypertension||1!!Memory Disorders||1
⇄⧉search_terms => string (1692) "aaa24969 mouse human monoclonal igg2a,k 4b6 purified by protein a affinity c...
$value[12]['_source']['search_terms']
aaa24969 mouse human monoclonal igg2a,k 4b6 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes stip1 elisa eia immunofluorescence if immunohistochemistry ihc immunoprecipitation ip western blot wb 10ug ml applications are based on unconjugated antibody analysis of expression transfected 293t cell line lane 1 lysate 62.6kd 2 non aaa24969_wb immunoperoxidase to formalin fixed paraffin embedded testis concentration 0.3ug aaa24969_ihc2 hela aaa24969_if3 using and magnetic bead immunoblotted rabbit polyclonal aaa24969_ip4 testing data detection limit for recombinant gst tagged is ~0.1ng capture aaa24969_td5 against immunogen 85.84kd aaa24969_wb6 aaa24969_wb7 stress induced phosphoprotein sti1 hsc70 hsp90 organizing hop p60 renal carcinoma antigen ny ren 11 sti1l transformation sensitive ief ssp 3521 homo sapiens mrna hel s 94n 59,778 da 12804256 bc002987 aah02987.1 p31948 q3zcu9 q5tzu9 b4dm70 f5h0t1 g3xad8 antibodies heat shock proteins full length corresponding aa1 544 from aah02987 tag mw the alone 26kd sequence meqvnelkekgnkalsvgniddalqcyseaikldphnhvlysnrsaayakkgdyqkayedgcktvdlkpdwgkgysrkaaaleflnrfeeakrtyeeglkheannpqlkeglqnmearlaerkfmnpfnmpnlyqklesdprtrtllsdptyrelieqlrnkpsdlgtklqdprimttlsvllgvdlgsmdeeeeiatpppppppkketkpepmeedlpenkkqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcrelcekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkcqqaekilkeqerlayinpdlaleeknkgnecfqkgdypqamkhyteaikrnpkdaklysnraacytkllefqlalkdceeciqleptfikgytrkaaaleamkdytkamdvyqkaldldssckeaadgyqrcmmaqynrhdspedvkrramadpevqqimsdpamrlileqmqkdpqalsehlknpviaqkiqklmdvgliair conjugate ph7.2 lane1 62.6kd2 ren11 aa1544
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value[13]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value[13]['_source']['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[13]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Flow Cytometry (FC/FACS), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[13]['_source']['app_notes']
⇄⧉testing_protocols => string (1091) "FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclo...
$value[13]['_source']['testing_protocols']
FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclonal antibody clone 2E1 (Green) and non-stained ES-2 cells (Black) as negative control.||AAA26274_FCM6.jpg!!FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclonal antibody clone 2E1 (Green) and non-stained ES-2 cells (Black) as negative control.||AAA26274_FCM5.jpg!!FCM (Flow Cytometry)||FACS analysis of 293 cells stained with STIP1 monoclonal antibody clone 2E1 (Green) and non-stained 293 cells (Black) as negative control.||AAA26274_FCM4.jpg!!FCM (Flow Cytometry)||FACS analysis of 293 cells stained with STIP1 monoclonal antibody clone 2E1 (Green) and non-stained 293 cells (Black) as negative control.||AAA26274_FCM3.jpg!!FCM (Flow Cytometry)||FACS analysis of HeLa cells stained with STIP1 monoclonal antibody clone 2E1 (Green) and non-stained HeLa cells (Black) as negative control.||AAA26274_FCM2.jpg!!FCM (Flow Cytometry)||FACS analysis of HeLa cells stained with STIP1 monoclonal antibody clone 2E1 (Green) and non-stained HeLa cells (Black) as negative control.||AAA26274_FCM.jpg
⇄⧉products_description => string (517) "STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSP...
$value[13]['_source']['products_description']
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]). [supplied by OMIM]
⇄⧉search_terms => string (708) "aaa26274 mouse monoclonal igg1,k 20 purified supplied as a liquid in pbs ph ...
$value[13]['_source']['search_terms']
aaa26274 mouse monoclonal igg1,k 20 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes stip1 flow cytometry fc facs immunofluorescence if immunohistochemistry ihc western blot wb applications are based on unconjugated antibody analysis of hela cells stained clone 2e1 green and non black negative control aaa26274_fc aaa26274_fc2 293 aaa26274_fc3 aaa26274_fc4 es 2 aaa26274_fc5 aaa26274_fc6 stress induced phosphoprotein 1 hop ief ssp 3521 p60 sti1 sti1l hel s 94n 12804257 aah02987.1 p31948 antibodies proteins immunogen 1aa 543aa full length recombinant protein gst tag mw the alone is 26kd conjugate igg1,k20 ph7.2 clone2e1 aaa26274_fc2293 es2 phosphoprotein1
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value[14]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value[14]['_source']['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[14]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Flow Cytometry (FC/FACS), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[14]['_source']['app_notes']
⇄⧉testing_protocols => string (1097) "FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclo...
$value[14]['_source']['testing_protocols']
FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained ES-2 cells (Black) as negative control.||AAA26275_FCM6.jpg!!FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained ES-2 cells (Black) as negative control.||AAA26275_FCM5.jpg!!FCM (Flow Cytometry)||FACS analysis of 293 cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained 293 cells (Black) as negative control.||AAA26275_FCM4.jpg!!FCM (Flow Cytometry)||FACS analysis of 293 cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained 293 cells (Black) as negative control.||AAA26275_FCM3.jpg!!FCM (Flow Cytometry)||FACS analysis of HeLa cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained HeLa cells (Black) as negative control.||AAA26275_FCM2.jpg!!FCM (Flow Cytometry)||FACS analysis of HeLa cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained HeLa cells (Black) as negative control.||AAA26275_FCM.jpg
⇄⧉products_description => string (517) "STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSP...
$value[14]['_source']['products_description']
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]). [supplied by OMIM]
⇄⧉products_references => string (856) "1. Immunohistological analysis of stress-induced phosphoprotein 1 in ovarian...
$value[14]['_source']['products_references']
1. Immunohistological analysis of stress-induced phosphoprotein 1 in ovarian cancer patients with low serum cancer antigen 125 levels. Chao A, Lee LY, Hsueh C, Lin CY, Tsai CL, Chao AS, Lin CT, Chou HH, Chang TC, Wang THTaiwan J Obstet Gynecol. 2013 Jun;52(2):185-91. doi: 10.1016/j.tjog.2013.04.006. 2. Tumor Stress-Induced Phosphoprotein1 (STIP1) as a Prognostic Biomarker in Ovarian Cancer. Chao A, Lai CH, Tsai CL, Hsueh S, Hsueh C, Lin CY, Chou HH, Lin YJ, Chen HW, Chang TC, Wang THPLoS One. 2013;8(2):e57084. doi: 10.1371/journal.pone.0057084. Epub 2013 Feb 27. 3. Stress-induced phosphoprotein 1 as a secreted biomarker for human ovarian cancer promotes cancer cell proliferation. Wang TH, Chao A, Tsai CL, Chang CL, Chen SH, Lee YS, Chen JK, Lin YJ, Chang PY, Wang CJ, Chao AS, Chang SD, Chang TC, Lai CH, Wang HS.Mol Cell Proteomics. 2010 May 25.
⇄⧉search_terms => string (696) "aaa26275 mouse monoclonal igg1,k 2.0e+11 purified supplied as a liquid in pb...
$value[14]['_source']['search_terms']
aaa26275 mouse monoclonal igg1,k 2.0e+11 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes stip1 flow cytometry fc facs immunofluorescence if immunohistochemistry ihc western blot wb applications are based on unconjugated antibody analysis of hela cells stained clone 2e11 green and non black negative control aaa26275_fc aaa26275_fc2 293 aaa26275_fc3 aaa26275_fc4 es 2 aaa26275_fc5 aaa26275_fc6 stress induced phosphoprotein 1 hop ief ssp 3521 p60 sti1 sti1l hel s 94n 12804257 aah02987.1 p31948 antibodies proteins immunogen 1aa 543aa full length recombinant protein gst tag mw the alone is 26kd conjugate ph7.2 aaa26275_fc2293 es2 phosphoprotein1
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value[15]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value[15]['_source']['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[15]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (55) "ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)"
$value[15]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[15]['_source']['app_notes']
⇄⧉testing_protocols => string (815) "Application Data||Detection limit for recombinant GST tagged STIP1 is 0.03 n...
$value[15]['_source']['testing_protocols']
Application Data||Detection limit for recombinant GST tagged STIP1 is 0.03 ng/ml as a capture antibody.||AAA26281_APP6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26281_IF5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26281_IF4.jpg!!WB (Western Blot)||STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in NIH/3T3.||AAA26281_WB3.jpg!!WB (Western Blot)||STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in PC-12.||AAA26281_WB2.jpg!!WB (Western Blot)||STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in Raw 264.7.||AAA26281_WB.jpg
Immunogen||STIP1 (NP_006810.1, 445aa-543aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR!!Conjugate||Biotin
1. Secreted Stress-Induced Phosphoprotein 1 Activates the ALK2-SMAD Signaling Pathways and Promotes Cell Proliferation of Ovarian Cancer Cells. Tsai CL, Tsai CN, Lin CY, Chen HW, Lee YS, Chao A, Wang TH, Wang HS, Lai CH.Cell Rep. 2012 Aug 30;2(2):283-93. Epub 2012 Aug 9.
⇄⧉products_related_diseases => string (235) "Inflammation||7!!Nervous System Diseases||7!!Brain Diseases||4!!Liver Diseas...
⇄⧉search_terms => string (1042) "aaa26281 mouse monoclonal igg2a,k 1c6 purified supplied as a liquid in pbs p...
$value[15]['_source']['search_terms']
aaa26281 mouse monoclonal igg2a,k 1c6 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes stip1 elisa eia immunofluorescence if western blot wb applications are based on unconjugated antibody m06 clone analysis of expression raw 264.7 aaa26281_wb pc 12 aaa26281_wb2 nih 3t3 aaa26281_wb3 to hela cell concentration 10 ug ml aaa26281_if4 aaa26281_if5 testing data detection limit for recombinant gst tagged is 0.03 ng capture aaa26281_td6 stress induced phosphoprotein 1 hop ief ssp 3521 p60 sti1 sti1l isoform b hel s 94n ny ren 11 antigen hsp70 hsp90 organizing protein hsc70 renal carcinoma transformation sensitive epididymis secretory sperm binding li 62,639 da stip1_human 5803181 np_006810.1 p31948 nm_006819.2 q3zcu9 q5tzu9 b4dm70 f5h0t1 g3xad8 605063 antibodies proteins immunogen 445aa 543aa partial tag mw the alone 26kd sequence tkamdvyqkaldldssckeaadgyqrcmmaqynrhdspedvkrramadpevqqimsdpamrlileqmqkdpqalsehlknpviaqkiqklmdvgliair conjugate ph7.2 pc12 concentration10 phosphoprotein1 ren11
⇄⧉form => string (102) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with hor...
$value[16]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
⇄concentration => string (3) "N/A"
$value[16]['_source']['concentration']
⇄⧉storage_stability => string (537) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[16]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (55) "ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)"
$value[16]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[16]['_source']['app_notes']
⇄⧉testing_protocols => string (815) "Application Data||Detection limit for recombinant GST tagged STIP1 is 0.03 n...
$value[16]['_source']['testing_protocols']
Application Data||Detection limit for recombinant GST tagged STIP1 is 0.03 ng/ml as a capture antibody.||AAA26547_APP6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26547_IF5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26547_IF4.jpg!!WB (Western Blot)||STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in NIH/3T3.||AAA26547_WB3.jpg!!WB (Western Blot)||STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in PC-12.||AAA26547_WB2.jpg!!WB (Western Blot)||STIP1 monoclonal antibody (M06), clone 1C6. Western Blot analysis of STIP1 expression in Raw 264.7.||AAA26547_WB.jpg
Immunogen||STIP1 (NP_006810.1, 445aa-543aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR!!Conjugate||HRP
1. Secreted Stress-Induced Phosphoprotein 1 Activates the ALK2-SMAD Signaling Pathways and Promotes Cell Proliferation of Ovarian Cancer Cells. Tsai CL, Tsai CN, Lin CY, Chen HW, Lee YS, Chao A, Wang TH, Wang HS, Lai CH.Cell Rep. 2012 Aug 30;2(2):283-93. Epub 2012 Aug 9.
⇄⧉products_related_diseases => string (235) "Inflammation||7!!Nervous System Diseases||7!!Brain Diseases||4!!Liver Diseas...
⇄⧉search_terms => string (1062) "aaa26547 mouse monoclonal igg2a,k 1c6 purified supplied as a liquid in pbs p...
$value[16]['_source']['search_terms']
aaa26547 mouse monoclonal igg2a,k 1c6 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes stip1 elisa eia immunofluorescence if western blot wb applications are based on unconjugated antibody m06 clone analysis of expression raw 264.7 aaa26547_wb pc 12 aaa26547_wb2 nih 3t3 aaa26547_wb3 to hela cell concentration 10 ug ml aaa26547_if4 aaa26547_if5 testing data detection limit for recombinant gst tagged is 0.03 ng capture aaa26547_td6 stress induced phosphoprotein 1 hop ief ssp 3521 p60 sti1 sti1l isoform b hel s 94n ny ren 11 antigen hsp70 hsp90 organizing protein hsc70 renal carcinoma transformation sensitive epididymis secretory sperm binding li 62,639 da stip1_human 5803181 np_006810.1 p31948 nm_006819.2 q3zcu9 q5tzu9 b4dm70 f5h0t1 g3xad8 605063 antibodies proteins immunogen 445aa 543aa partial tag mw the alone 26kd sequence tkamdvyqkaldldssckeaadgyqrcmmaqynrhdspedvkrramadpevqqimsdpamrlileqmqkdpqalsehlknpviaqkiqklmdvgliair conjugate ph7.2 pc12 concentration10 phosphoprotein1 ren11
⇄⧉form => string (99) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alk...
$value[17]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
⇄concentration => string (3) "N/A"
$value[17]['_source']['concentration']
⇄⧉storage_stability => string (304) "Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 mont...
$value[17]['_source']['storage_stability']
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (70) "Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)"
$value[17]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[17]['_source']['app_notes']
⇄⧉testing_protocols => string (1097) "FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclo...
$value[17]['_source']['testing_protocols']
FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained ES-2 cells (Black) as negative control.||AAA26009_FCM6.jpg!!FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained ES-2 cells (Black) as negative control.||AAA26009_FCM5.jpg!!FCM (Flow Cytometry)||FACS analysis of 293 cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained 293 cells (Black) as negative control.||AAA26009_FCM4.jpg!!FCM (Flow Cytometry)||FACS analysis of 293 cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained 293 cells (Black) as negative control.||AAA26009_FCM3.jpg!!FCM (Flow Cytometry)||FACS analysis of HeLa cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained HeLa cells (Black) as negative control.||AAA26009_FCM2.jpg!!FCM (Flow Cytometry)||FACS analysis of HeLa cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained HeLa cells (Black) as negative control.||AAA26009_FCM.jpg
⇄⧉products_description => string (517) "STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSP...
$value[17]['_source']['products_description']
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]). [supplied by OMIM]
⇄⧉products_references => string (856) "1. Immunohistological analysis of stress-induced phosphoprotein 1 in ovarian...
$value[17]['_source']['products_references']
1. Immunohistological analysis of stress-induced phosphoprotein 1 in ovarian cancer patients with low serum cancer antigen 125 levels. Chao A, Lee LY, Hsueh C, Lin CY, Tsai CL, Chao AS, Lin CT, Chou HH, Chang TC, Wang THTaiwan J Obstet Gynecol. 2013 Jun;52(2):185-91. doi: 10.1016/j.tjog.2013.04.006. 2. Tumor Stress-Induced Phosphoprotein1 (STIP1) as a Prognostic Biomarker in Ovarian Cancer. Chao A, Lai CH, Tsai CL, Hsueh S, Hsueh C, Lin CY, Chou HH, Lin YJ, Chen HW, Chang TC, Wang THPLoS One. 2013;8(2):e57084. doi: 10.1371/journal.pone.0057084. Epub 2013 Feb 27. 3. Stress-induced phosphoprotein 1 as a secreted biomarker for human ovarian cancer promotes cancer cell proliferation. Wang TH, Chao A, Tsai CL, Chang CL, Chen SH, Lee YS, Chen JK, Lin YJ, Chang PY, Wang CJ, Chao AS, Chang SD, Chang TC, Lai CH, Wang HS.Mol Cell Proteomics. 2010 May 25.
⇄⧉search_terms => string (713) "aaa26009 mouse monoclonal igg1,k 2.0e+11 purified supplied as a liquid in pb...
$value[17]['_source']['search_terms']
aaa26009 mouse monoclonal igg1,k 2.0e+11 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with alkaline phosphatase ap recognizes stip1 immunofluorescence if immunohistochemistry ihc western blot wb applications are based on unconjugated antibody flow cytometry fc facs analysis of hela cells stained clone 2e11 green and non black negative control aaa26009_fc aaa26009_fc2 293 aaa26009_fc3 aaa26009_fc4 es 2 aaa26009_fc5 aaa26009_fc6 stress induced phosphoprotein 1 hop ief ssp 3521 p60 sti1 sti1l hel s 94n 12804257 aah02987.1 p31948 antibodies proteins immunogen 1aa 543aa full length recombinant protein gst tag mw the alone is 26kd conjugate ph7.2 aaa26009_fc2293 es2 phosphoprotein1
⇄⧉form => string (102) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with hor...
$value[18]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
⇄concentration => string (3) "N/A"
$value[18]['_source']['concentration']
⇄⧉storage_stability => string (537) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[18]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Flow Cytometry (FC/FACS), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[18]['_source']['app_notes']
⇄⧉testing_protocols => string (1097) "FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclo...
$value[18]['_source']['testing_protocols']
FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained ES-2 cells (Black) as negative control.||AAA26541_FCM6.jpg!!FCM (Flow Cytometry)||FACS analysis of ES-2 cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained ES-2 cells (Black) as negative control.||AAA26541_FCM5.jpg!!FCM (Flow Cytometry)||FACS analysis of 293 cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained 293 cells (Black) as negative control.||AAA26541_FCM4.jpg!!FCM (Flow Cytometry)||FACS analysis of 293 cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained 293 cells (Black) as negative control.||AAA26541_FCM3.jpg!!FCM (Flow Cytometry)||FACS analysis of HeLa cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained HeLa cells (Black) as negative control.||AAA26541_FCM2.jpg!!FCM (Flow Cytometry)||FACS analysis of HeLa cells stained with STIP1 monoclonal antibody clone 2E11 (Green) and non-stained HeLa cells (Black) as negative control.||AAA26541_FCM.jpg
⇄⧉products_references => string (856) "1. Immunohistological analysis of stress-induced phosphoprotein 1 in ovarian...
$value[18]['_source']['products_references']
1. Immunohistological analysis of stress-induced phosphoprotein 1 in ovarian cancer patients with low serum cancer antigen 125 levels. Chao A, Lee LY, Hsueh C, Lin CY, Tsai CL, Chao AS, Lin CT, Chou HH, Chang TC, Wang THTaiwan J Obstet Gynecol. 2013 Jun;52(2):185-91. doi: 10.1016/j.tjog.2013.04.006. 2. Tumor Stress-Induced Phosphoprotein1 (STIP1) as a Prognostic Biomarker in Ovarian Cancer. Chao A, Lai CH, Tsai CL, Hsueh S, Hsueh C, Lin CY, Chou HH, Lin YJ, Chen HW, Chang TC, Wang THPLoS One. 2013;8(2):e57084. doi: 10.1371/journal.pone.0057084. Epub 2013 Feb 27. 3. Stress-induced phosphoprotein 1 as a secreted biomarker for human ovarian cancer promotes cancer cell proliferation. Wang TH, Chao A, Tsai CL, Chang CL, Chen SH, Lee YS, Chen JK, Lin YJ, Chang PY, Wang CJ, Chao AS, Chang SD, Chang TC, Lai CH, Wang HS.Mol Cell Proteomics. 2010 May 25.
⇄⧉search_terms => string (716) "aaa26541 mouse monoclonal igg1,k 2.0e+11 purified supplied as a liquid in pb...
$value[18]['_source']['search_terms']
aaa26541 mouse monoclonal igg1,k 2.0e+11 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes stip1 flow cytometry fc facs immunofluorescence if immunohistochemistry ihc western blot wb applications are based on unconjugated antibody analysis of hela cells stained clone 2e11 green and non black negative control aaa26541_fc aaa26541_fc2 293 aaa26541_fc3 aaa26541_fc4 es 2 aaa26541_fc5 aaa26541_fc6 stress induced phosphoprotein 1 hop ief ssp 3521 p60 sti1 sti1l hel s 94n 12804257 aah02987.1 p31948 antibodies proteins immunogen 1aa 543aa full length recombinant protein gst tag mw the alone is 26kd conjugate ph7.2 aaa26541_fc2293 es2 phosphoprotein1
⇄⧉specificity => string (171) "This assay has high sensitivity and excellent specificity for detection of S...
$value[19]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of STIP1. No significant cross-reactivity or interference between STIP1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[19]['_source']['purity']
⇄form => string (3) "N/A"
$value[19]['_source']['form']
⇄concentration => string (3) "N/A"
$value[19]['_source']['concentration']
⇄⧉storage_stability => string (475) "The stability of kit is determined by the loss rate of activity. The loss ra...
$value[19]['_source']['storage_stability']
The stability of kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. <br>To minimize extra influence on the performance, operation procedures and lab conditions, especially room temperature, air humidity, incubator temperature should be strictly controlled. It is also strongly suggested that the whole assay is performed by the same operator from the beginning to the end.
Assay Type||Double-antibody Sandwich!!Samples||Serum, Plasma, Tissue homogenates and other biological fluids!!Detection Range||1.56-100ng/mL!!Sensitivity||0.59ng/mL
⇄⧉etc_term2 => string (416) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[19]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level STIP1 were tested 20 times on one plate, respectively. Intra-Assay: CV<10%!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level STIP1 were tested on 3 different plates, 8 replicates in each plate. CV(%) = SD/meanX100. Inter-Assay: CV<12%
⇄⧉products_description => string (989) "Intended Uses: The kit is a sandwich enzyme immunoassay for in vitro quantit...
$value[19]['_source']['products_description']
Intended Uses: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of STIP1 in human serum, plasma, tissue homogenates and other biological fluids.<br><br>Principle of the Assay: The microplate provided in this kit has been pre-coated with an antibody specific to STIP1. Standards or samples are then added to the appropriate microplate wells with a biotin-conjugated antibody specific to STIP1. Next, Avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. After TMB substrate solution is added, only those wells that contain STIP1, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm +/- 10nm. The concentration of STIP1 in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄products_references => string (3) "N/A"
$value[19]['_source']['products_references']
⇄⧉products_related_diseases => string (209) "Inflammation||8!!Nervous System Diseases||8!!Brain Diseases||5!!Disease Mode...
⇄⧉search_terms => string (801) "aaa20469 human this assay has high sensitivity and excellent specificity for...
$value[19]['_source']['search_terms']
aaa20469 human this assay has high sensitivity and excellent specificity for detection of stip1 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa20469_sc elisa kit stress induced phosphoprotein 1 hop p60 ief ssp 3521 sti1l hsp70 hsp90 organizing protein renal carcinoma antigen ny ren 11 transformation sensitive isoform b sti1 hel s 94n 59,778 da hsc70 stip1_human 5803181 np_006810.1 p31948 nm_006819.2 q3zcu9 q5tzu9 b4dm70 f5h0t1 g3xad8 605063 immune molecule samples serum plasma tissue homogenates other biological fluids type quantitative sandwich range 1.56 100ng ml < 0.59ng intra precision within an 3 with low middle level were tested 20 times on one plate respectively cv phosphoprotein1 ren11 an3 tested20
