Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RLN1 expression in transfected 293T cell line by RLN1 polyclonal antibody. Lane 1: RLN1 transfected lysate (21.1kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human Relaxin 1 Polyclonal Antibody | anti-Rln1 antibody

Relaxin 1 (Rln1, Prorelaxin 1, Rln, Relaxin B Chain, Relaxin A Chain) (HRP)

Gene Names
RLN1; H1; H1RLX; RLXH1; bA12D24.3.1; bA12D24.3.2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Relaxin 1; Polyclonal Antibody; Relaxin 1 (Rln1; Prorelaxin 1; Rln; Relaxin B Chain; Relaxin A Chain) (HRP); anti-Rln1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RLN1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-Rln1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human RLN1, aa1-185 (NP_008842.1).
Immunogen Sequence
MPRLFLFHLLEFCLLLNQFSRAVAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RLN1 expression in transfected 293T cell line by RLN1 polyclonal antibody. Lane 1: RLN1 transfected lysate (21.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RLN1 expression in transfected 293T cell line by RLN1 polyclonal antibody. Lane 1: RLN1 transfected lysate (21.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-Rln1 antibody
Relaxin is a peptide hormone belonging to the insulin gene superfamily. It is made by the corpora lutea of the ovaries during pregnancy in many mammalian species. The secretion of the hormone into the blood stream just before parturition results in softening and lengthening of the pubic symphysis and a softening of the cervix, which facilitates the process of birth. Relaxin-1 is proteolytically processed into a hetorodimer that has two peptide chains, A and B that are covalently linked by disulfide bonds.
Product Categories/Family for anti-Rln1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,011 Da
NCBI Official Full Name
prorelaxin H1 preproprotein
NCBI Official Synonym Full Names
relaxin 1
NCBI Official Symbol
RLN1
NCBI Official Synonym Symbols
H1; H1RLX; RLXH1; bA12D24.3.1; bA12D24.3.2
NCBI Protein Information
prorelaxin H1
UniProt Protein Name
Prorelaxin H1
Protein Family
UniProt Gene Name
RLN1
UniProt Entry Name
REL1_HUMAN

NCBI Description

Relaxins are known endocrine and autocrine/paracrine hormones, belonging to the insulin gene superfamily. In humans there are three non-allelic relaxin genes, RLN1, RLN2 and RLN3, where RLN1 and RLN2 share high sequence homology. The protein encoded by this gene is synthesized as a single-chain polypeptide but the active form consists of an A chain and a B chain linked by disulfide bonds. Relaxin is produced by the ovary, and targets the mammalian reproductive system to ripen the cervix, elongate the pubic symphysis and inhibit uterine contraction. It may have additional roles in enhancing sperm motility, regulating blood pressure, controlling heart rate and releasing oxytocin and vasopressin. [provided by RefSeq, Jan 2013]

Uniprot Description

RLN1: Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix. Belongs to the insulin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 9p24.1

Cellular Component: extracellular region

Molecular Function: hormone activity

Biological Process: female pregnancy; signal transduction

Research Articles on Rln1

Similar Products

Product Notes

The Rln1 rln1 (Catalog #AAA6392324) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Relaxin 1 (Rln1, Prorelaxin 1, Rln, Relaxin B Chain, Relaxin A Chain) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Relaxin 1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the Rln1 rln1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Relaxin 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.