Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of REG3A expression in transfected 293T cell line by REG3A polyclonal antibody. Lane 1: REG3A transfected lysate (19.4kD). Lane 2: Non-transfected lysate)

Rabbit anti-Human Regenerating Islet-derived Protein 3-alpha Polyclonal Antibody | anti-REG3A antibody

Regenerating Islet-derived Protein 3-alpha (REG-3-alpha, REG3A, REG3, Regenerating Islet-derived Protein III-alpha, Reg III-alpha, REG-III, FLJ18565, HIP, Human Proislet Peptide, Pancreatitis-associated Protein 1, PAP1, PAP, PAP-H, PBCGF) (PE)

Gene Names
REG3A; HIP; PAP; PAP1; REG3; INGAP; PAP-H; PBCGF; HIP/PAP; REG-III
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Regenerating Islet-derived Protein 3-alpha; Polyclonal Antibody; Regenerating Islet-derived Protein 3-alpha (REG-3-alpha; REG3A; REG3; Regenerating Islet-derived Protein III-alpha; Reg III-alpha; REG-III; FLJ18565; HIP; Human Proislet Peptide; Pancreatitis-associated Protein 1; PAP1; PAP; PAP-H; PBCGF) (PE); anti-REG3A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human REG3A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-REG3A antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human REG3A, aa1-175 (NP_002571.1).
Immunogen Sequence
MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of REG3A expression in transfected 293T cell line by REG3A polyclonal antibody. Lane 1: REG3A transfected lysate (19.4kD). Lane 2: Non-transfected lysate)

Western Blot (WB) (Western Blot analysis of REG3A expression in transfected 293T cell line by REG3A polyclonal antibody. Lane 1: REG3A transfected lysate (19.4kD). Lane 2: Non-transfected lysate)
Related Product Information for anti-REG3A antibody
REG3A, also known as Regenerating islet-derived protein 3 alpha, Reg III-alpha, and pancreatitis associated protein, is a 174aa containing stress protein involved in the control of bacterial proliferation. This secreted protein is generally found in the apical region of pancreatic acinar cells and appears in pancreatic juice after induction of pancreatic inflammation. It has a possible role in inducing new pancreatic islets development. REG3A belongs to the Reg-related family with a C-type lectin domain and is constitutively expressed in intestine while low expression is found in healthy pancreas. Overexpression of REG3A is seen during the acute phase of pancreatitis and in some patients with chronic pancreatitis.
Product Categories/Family for anti-REG3A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,395 Da
NCBI Official Full Name
regenerating islet-derived protein 3-alpha
NCBI Official Synonym Full Names
regenerating islet-derived 3 alpha
NCBI Official Symbol
REG3A
NCBI Official Synonym Symbols
HIP; PAP; PAP1; REG3; INGAP; PAP-H; PBCGF; HIP/PAP; REG-III
NCBI Protein Information
regenerating islet-derived protein 3-alpha; REG-3-alpha; reg III-alpha; PAP homologous protein; human proislet peptide; pancreatitis-associated protein 1; proliferation-inducing protein 34; proliferation-inducing protein 42; hepatocarcinoma-intestine-panc
UniProt Protein Name
Regenerating islet-derived protein 3-alpha
UniProt Gene Name
REG3A
UniProt Synonym Gene Names
HIP; PAP; PAP1; REG-3-alpha; HIP/PAP
UniProt Entry Name
REG3A_HUMAN

NCBI Description

This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. Alternate splicing results in multiple transcript variants that encode the same protein.[provided by RefSeq, Dec 2010]

Uniprot Description

REG3A: Might be a stress protein involved in the control of bacterial proliferation.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 2p12

Cellular Component: extracellular space; cytoplasm

Molecular Function: carbohydrate binding

Biological Process: heterophilic cell adhesion; cell proliferation; multicellular organismal development; negative regulation of keratinocyte differentiation; acute-phase response

Research Articles on REG3A

Similar Products

Product Notes

The REG3A reg3a (Catalog #AAA6392319) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Regenerating Islet-derived Protein 3-alpha (REG-3-alpha, REG3A, REG3, Regenerating Islet-derived Protein III-alpha, Reg III-alpha, REG-III, FLJ18565, HIP, Human Proislet Peptide, Pancreatitis-associated Protein 1, PAP1, PAP, PAP-H, PBCGF) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Regenerating Islet-derived Protein 3-alpha can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the REG3A reg3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Regenerating Islet-derived Protein 3-alpha, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.