Rabbit anti-Human Recoverin Polyclonal Antibody | anti-RCVRN antibody

Recoverin (Cancer-associated Retinopathy Protein, Protein CAR, RCVRN, RCV1) (Biotin)

Cat. Num. AAA6392289

• Gene Names: RCVRN; RCV1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Recoverin; Polyclonal Antibody; Recoverin (Cancer-associated Retinopathy Protein; Protein CAR; RCVRN; RCV1) (Biotin); anti-RCVRN antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human RCVRN.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-RCVRN antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human RCVRN, aa1-200 (NP_002894.1).
• Immunogen Sequence: MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RCVRN expression in transfected 293T cell line by RCVRN polyclonal antibody. Lane 1: RCVRN transfected lysate (23.1kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-RCVRN antibody

Recoverin belongs to a high-affinity calcium-binding family that includes neuronal calcium sensor-1, visinin-like proteins (VILIPs), guanylate cyclase-activating proteins (GCAPs), and Kv-channel interacting proteins (KchIPs). Features common to this family include four calcium-binding EF-hand domains, and an N-terminal myristoylation sequence. This family of proteins has been implicated in a broad range of cellular signaling functions, including phototransduction and neurotransmitter release, lipid metabolism, gene expression, and ion channel regulation. Myristoylation, the post-translational addition of a fatty acid tail, has been shown to have functional significance for other calcium-binding protein family members. Recoverin is subject to the posttranslational modification of myristoylation. Binding of calcium to recoverin elicits a change in conformation that exposes the buried hydrophobic myristoyl moiety to interaction with cell membranes and other cellular proteins.

Product Categories/Family for anti-RCVRN antibody

Antibodies; Cancer Markers

NCBI and Uniprot Product Information

• NCBI GI #: 4506459
• NCBI GeneID: 5957
• NCBI Accession #: NP_002894.1
• NCBI GenBank Nucleotide #: NM_002903.2
• UniProt Accession #: P35243
• Molecular Weight: 23,130 Da
• NCBI Official Full Name: recoverin
• NCBI Official Synonym Full Names: recoverin
• NCBI Official Symbol: RCVRN
• NCBI Official Synonym Symbols: RCV1
• NCBI Protein Information: recoverin; cancer associated retinopathy antigen; cancer-associated retinopathy protein
• UniProt Protein Name: Recoverin
• Protein Family: Recoverin
• UniProt Gene Name: RCVRN
• UniProt Synonym Gene Names: RCV1; Protein CAR
• UniProt Entry Name: RECO_HUMAN

NCBI Description

This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. [provided by RefSeq, Jul 2008]

Uniprot Description

RCV1: Seems to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse. Belongs to the recoverin family.

Protein type: Calcium-binding

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: dendrite

Molecular Function: calcium sensitive guanylate cyclase activator activity; calcium ion binding

Biological Process: rhodopsin mediated signaling; phototransduction, visible light; regulation of rhodopsin mediated signaling; visual perception; positive regulation of guanylate cyclase activity; regulation of calcium ion transport; signal transduction