Western Blot (WB)
(Host: RabbitTarget Name: RCN2Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human RCN2 Polyclonal Antibody | anti-RCN2 antibody
RCN2 Antibody - middle region
Gene Names
RCN2; E6BP; ERC55; ERC-55; TCBP49
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RCN2; Polyclonal Antibody; RCN2 Antibody - middle region; anti-RCN2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEFV
Sequence Length
335
Applicable Applications for anti-RCN2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RCN2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: RCN2Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RCN2Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RCN2 antibody
The protein encoded by this gene is a calcium-binding protein located in the lumen of the ER. The protein contains six conserved regions with similarity to a high affinity Ca(+2)-binding motif, the EF-hand. This gene maps to the same region as type 4 Bardet-Biedl syndrome, suggesting a possible causative role for this gene in the disorder. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-RCN2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39 kDa
NCBI Official Full Name
reticulocalbin-2 isoform b
NCBI Official Synonym Full Names
reticulocalbin 2
NCBI Official Symbol
RCN2
NCBI Official Synonym Symbols
E6BP; ERC55; ERC-55; TCBP49
NCBI Protein Information
reticulocalbin-2
UniProt Protein Name
Reticulocalbin-2
Protein Family
UniProt Gene Name
RCN2
UniProt Synonym Gene Names
ERC55; E6BP
UniProt Entry Name
RCN2_HUMAN
NCBI Description
The protein encoded by this gene is a calcium-binding protein located in the lumen of the ER. The protein contains six conserved regions with similarity to a high affinity Ca(+2)-binding motif, the EF-hand. This gene maps to the same region as type 4 Bardet-Biedl syndrome, suggesting a possible causative role for this gene in the disorder. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2012]
Uniprot Description
RCN2: Not known. Binds calcium. Belongs to the CREC family.
Protein type: Endoplasmic reticulum
Chromosomal Location of Human Ortholog: 15q23
Cellular Component: endoplasmic reticulum lumen; endoplasmic reticulum; nucleolus
Molecular Function: protein binding; calcium ion binding
Research Articles on RCN2
Similar Products
Product Notes
The RCN2 rcn2 (Catalog #AAA3222659) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RCN2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RCN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RCN2 rcn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DAEEESFRKL HLKDKKRFEK ANQDSGPGLS LEEFIAFEHP EEVDYMTEFV. It is sometimes possible for the material contained within the vial of "RCN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
