Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RCHY1Sample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human RCHY1 Polyclonal Antibody | anti-RCHY1 antibody

RCHY1 Antibody - middle region

Gene Names
RCHY1; ZCHY; ARNIP; CHIMP; PIRH2; RNF199; ZNF363; PRO1996
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RCHY1; Polyclonal Antibody; RCHY1 Antibody - middle region; anti-RCHY1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTCEECSTLFGEYYCDI
Sequence Length
261
Applicable Applications for anti-RCHY1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RCHY1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RCHY1Sample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RCHY1Sample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RCHY1 antibody
The protein encoded by this gene has ubiquitin ligase activity. It mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including tumor protein 53, histone deacetylase 1, and cyclin-dependent kinase inhibitor 1B, thus regulating their levels and cell cycle progression. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Product Categories/Family for anti-RCHY1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28 kDa
NCBI Official Full Name
RING finger and CHY zinc finger domain-containing protein 1 isoform 3
NCBI Official Synonym Full Names
ring finger and CHY zinc finger domain containing 1
NCBI Official Symbol
RCHY1
NCBI Official Synonym Symbols
ZCHY; ARNIP; CHIMP; PIRH2; RNF199; ZNF363; PRO1996
NCBI Protein Information
RING finger and CHY zinc finger domain-containing protein 1
UniProt Protein Name
RING finger and CHY zinc finger domain-containing protein 1
UniProt Gene Name
RCHY1
UniProt Synonym Gene Names
ARNIP; CHIMP; PIRH2; RNF199; ZNF363; hPirh2
UniProt Entry Name
ZN363_HUMAN

NCBI Description

The protein encoded by this gene has ubiquitin ligase activity. It mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including tumor protein 53, histone deacetylase 1, and cyclin-dependent kinase inhibitor 1B, thus regulating their levels and cell cycle progression. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jun 2013]

Uniprot Description

RCHY1: Mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including p53/TP53, HDAC1 and p27Kip1. Preferentially acts on tetrameric p53/TP53. Contributes to the regulation of p27Kip1 and p53/TP53 levels, and thereby contributes to the regulation of the cell cycle progression. Increases AR transcription factor activity. Monomer and homodimer. Interacts with AR, p53/TP53, MDM2, HDAC1, KAT5, PLAG1, PLAGL2, p27Kip1, COPE, UBE2D2 and GORAB/NTKLBP1. Up-regulated during the S phase of the cell cycle. Expressed at low levels during G phase. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin ligase; Ubiquitin conjugating system; Nuclear receptor co-regulator; EC 6.3.2.-; EC 6.3.2.19

Chromosomal Location of Human Ortholog: 4q21.1

Cellular Component: nucleoplasm; cytoplasm; nuclear speck; nucleus; ubiquitin ligase complex

Molecular Function: protein binding; protein homodimerization activity; zinc ion binding; p53 binding; ubiquitin-protein ligase activity; ligase activity; receptor binding

Biological Process: protein autoubiquitination; positive regulation of protein ubiquitination; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; protein ubiquitination during ubiquitin-dependent protein catabolic process; protein ubiquitination

Research Articles on RCHY1

Similar Products

Product Notes

The RCHY1 rchy1 (Catalog #AAA3223284) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RCHY1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RCHY1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RCHY1 rchy1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CRLCHDNNED HQLDRFKVKE VQCINCEKIQ HAQQTCEECS TLFGEYYCDI. It is sometimes possible for the material contained within the vial of "RCHY1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.