Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Mouse RetinaFixation of the tissues with 4% paraformaldehyde in 0.1M PO4, and performed typical procedures of immunocytochemistry. Blocking solution was 0.2% triton X-100 + 5% normal donkey serum in PBS. RBPMS antibody was incubated in blocking solution with 1:200 dilution (4 degree, overnight). Secondary antibody was Cy3-conjugated.)

Rabbit RBPMS Polyclonal Antibody | anti-RBPMS antibody

RBPMS antibody - N-terminal region

Gene Names
RBPMS; HERMES
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot, Immunocytochemistry
Purity
Protein A purified
Synonyms
RBPMS; Polyclonal Antibody; RBPMS antibody - N-terminal region; anti-RBPMS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQ
Sequence Length
219
Applicable Applications for anti-RBPMS antibody
Immunohistochemistry (IHC), Western Blot (WB), Immunocytochemistry (ICC)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RBPMS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Mouse RetinaFixation of the tissues with 4% paraformaldehyde in 0.1M PO4, and performed typical procedures of immunocytochemistry. Blocking solution was 0.2% triton X-100 + 5% normal donkey serum in PBS. RBPMS antibody was incubated in blocking solution with 1:200 dilution (4 degree, overnight). Secondary antibody was Cy3-conjugated.)

Immunohistochemistry (IHC) (Mouse RetinaFixation of the tissues with 4% paraformaldehyde in 0.1M PO4, and performed typical procedures of immunocytochemistry. Blocking solution was 0.2% triton X-100 + 5% normal donkey serum in PBS. RBPMS antibody was incubated in blocking solution with 1:200 dilution (4 degree, overnight). Secondary antibody was Cy3-conjugated.)
Related Product Information for anti-RBPMS antibody
This is a rabbit polyclonal antibody against RBPMS. It was validated on Western Blot and immunohistochemistry

Target Description: RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. RBPMS has a single, putative RRM domain in its N-terminus.This gene encodes a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. The protein encoded by this gene has a single, putative RRM domain in its N-terminus. Alternative splicing results in multiple transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
RNA-binding protein with multiple splicing isoform C
NCBI Official Synonym Full Names
RNA binding protein, mRNA processing factor
NCBI Official Symbol
RBPMS
NCBI Official Synonym Symbols
HERMES
NCBI Protein Information
RNA-binding protein with multiple splicing
UniProt Protein Name
RNA-binding protein with multiple splicing
UniProt Gene Name
RBPMS
UniProt Synonym Gene Names
HERMES; RBP-MS; Hermes
UniProt Entry Name
RBPMS_HUMAN

NCBI Description

This gene encodes a member of the RNA recognition motif family of RNA-binding proteins. The RNA recognition motif is between 80-100 amino acids in length and family members contain one to four copies of the motif. The RNA recognition motif consists of two short stretches of conserved sequence, as well as a few highly conserved hydrophobic residues. The encoded protein has a single, putative RNA recognition motif in its N-terminus. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2013]

Uniprot Description

RBPMS: Acts as a coactivator of transcriptional activity. Required to increase TGFB1/Smad-mediated transactivation. Acts through SMAD2, SMAD3 and SMAD4 to increase transcriptional activity. Increases phosphorylation of SMAD2 and SMAD3 on their C- terminal SSXS motif, possibly through recruitment of TGFBR1. Promotes the nuclear accumulation of SMAD2, SMAD3 and SMAD4 proteins. Binds to poly(A) RNA. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 8p12

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: protein binding; transcription coactivator activity; nucleotide binding; poly(A) binding

Biological Process: RNA processing; regulation of transcription, DNA-dependent; transcription, DNA-dependent

Research Articles on RBPMS

Similar Products

Product Notes

The RBPMS rbpms (Catalog #AAA3205110) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBPMS antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RBPMS can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB), Immunocytochemistry (ICC). Researchers should empirically determine the suitability of the RBPMS rbpms for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LFRPFKGYEG SLIKLTSKQP VGFVSFDSRS EAEAAKNALN GIRFDPEIPQ. It is sometimes possible for the material contained within the vial of "RBPMS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.