Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using RBM4B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)
Rabbit anti-Human RBM4B Polyclonal Antibody | anti-RBM4B antibody
RBM4B Polyclonal Antibody
Gene Names
RBM4B; RBM30; RBM4L; ZCRB3B; ZCCHC15; ZCCHC21B
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
RBM4B; Polyclonal Antibody; RBM4B Polyclonal Antibody; RBM30; RBM4L; ZCCHC15; ZCCHC21B; ZCRB3B; anti-RBM4B antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
RMHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPVDRTGRVADFTEQYNEQYGAVRTPYTMGYGESMYYNDAYGALDYYKRYRVRSYEAVAAAAAASAYNYAEQTMSHLPQVQSTTVTSHLNSTSVDPYDRHLLPNSGAAATSAAMAAAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSLYDMARYEREQYVDRARYSAF
Sequence Length
143
Applicable Applications for anti-RBM4B antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
A synthetic peptide of human RBM4B
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus, nucleolus
Positive Samples
LO2, U-87MG, Raji
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using RBM4B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using RBM4B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)
Product Categories/Family for anti-RBM4B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 40kDa
Observed: 45kDa
Observed: 45kDa
NCBI Official Full Name
RNA-binding protein 4B isoform 2
NCBI Official Synonym Full Names
RNA binding motif protein 4B
NCBI Official Symbol
RBM4B
NCBI Official Synonym Symbols
RBM30; RBM4L; ZCRB3B; ZCCHC15; ZCCHC21B
NCBI Protein Information
RNA-binding protein 4B
UniProt Protein Name
RNA-binding protein 4B
Protein Family
UniProt Gene Name
RBM4B
UniProt Synonym Gene Names
RBM30
Uniprot Description
Required for the translational activation of PER1 mRNA in response to circadian clock. Binds directly to the 3'-UTR of the PER1 mRNA ().
Similar Products
Product Notes
The RBM4B rbm4b (Catalog #AAA9134676) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBM4B Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBM4B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the RBM4B rbm4b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RMHVQLSTSR LRTAPGMGDQ SGCYRCGKEG HWSKECPVDR TGRVADFTEQ YNEQYGAVRT PYTMGYGESM YYNDAYGALD YYKRYRVRSY EAVAAAAAAS AYNYAEQTMS HLPQVQSTTV TSHLNSTSVD PYDRHLLPNS GAAATSAAMA AAAATTSSYY GRDRSPLRRA AAMLPTVGEG YGYGPESELS QASAATRNSL YDMARYEREQ YVDRARYSAF. It is sometimes possible for the material contained within the vial of "RBM4B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
