Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using RBM45 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

Rabbit anti-Mouse RBM45 Polyclonal Antibody | anti-RBM45 antibody

RBM45 Polyclonal Antibody

Gene Names
RBM45; DRB1; RB-1
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
RBM45; Polyclonal Antibody; RBM45 Polyclonal Antibody; DRB1; RB-1; anti-RBM45 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGDIQDIWVVRDKHTKESKGIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQSRSSGSHRDVEDEELTRIFVMIPKSYTEEDLREKFKVYGDIEYCSIIKNKVTGESKGLGYVRYLKPSQAAQAIENCDRSFRAILAEPKNKASESSEQDYYSNMRQEALGHEPRVNMFPFEQQSEFSSFDKNDSRGQEAISKRLSVVSRVP
Sequence Length
474
Applicable Applications for anti-RBM45 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human RBM45
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Nucleus
Positive Samples
Mouse brain, Mouse heart, Mouse kidney
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using RBM45 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using RBM45 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-RBM45 antibody
This gene encodes a member of the RNA recognition motif (RRM)-type RNA-binding family of proteins. This protein exhibits preferential binding to poly(C) RNA. Initial cloning of this gene found that the rat ortholog was dynamically expressed in the developing rat brain. This protein has been localized to inclusion bodies in the brain and spinal cord of amyotrophic lateral sclerosis and Alzheimer's patients. A pseudogene has been identified on chromosome 8.
Product Categories/Family for anti-RBM45 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 37kDa; 53kDa
Observed: 52-54kDa
NCBI Official Full Name
RNA-binding protein 45
NCBI Official Synonym Full Names
RNA binding motif protein 45
NCBI Official Symbol
RBM45
NCBI Official Synonym Symbols
DRB1; RB-1
NCBI Protein Information
RNA-binding protein 45
UniProt Protein Name
RNA-binding protein 45
Protein Family
UniProt Gene Name
RBM45
UniProt Synonym Gene Names
; RB-1

NCBI Description

This gene encodes a member of the RNA recognition motif (RRM)-type RNA-binding family of proteins. This protein exhibits preferential binding to poly(C) RNA. Initial cloning of this gene found that the rat ortholog was dynamically expressed in the developing rat brain. This protein has been localized to inclusion bodies in the brain and spinal cord of amyotrophic lateral sclerosis and Alzheimer's patients. A pseudogene has been identified on chromosome 8. [provided by RefSeq, Feb 2015]

Uniprot Description

RNA-binding protein with binding specificity for poly(C). May play an important role in neural development.

Research Articles on RBM45

Similar Products

Product Notes

The RBM45 rbm45 (Catalog #AAA9133859) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBM45 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's RBM45 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the RBM45 rbm45 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDEAGSSASG GGFRPGVDSL DEPPNSRIFL VISKYTPESV LRERFSPFGD IQDIWVVRDK HTKESKGIAF VKFARSSQAC RAMEEMHGQC LGPNDTKPIK VFIAQSRSSG SHRDVEDEEL TRIFVMIPKS YTEEDLREKF KVYGDIEYCS IIKNKVTGES KGLGYVRYLK PSQAAQAIEN CDRSFRAILA EPKNKASESS EQDYYSNMRQ EALGHEPRVN MFPFEQQSEF SSFDKNDSRG QEAISKRLSV VSRVP. It is sometimes possible for the material contained within the vial of "RBM45, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.