Western Blot (WB)
(WB Suggested Anti-RBM42 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)
Rabbit RBM42 Polyclonal Antibody | anti-RBM42 antibody
RBM42 antibody - middle region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RBM42; Polyclonal Antibody; RBM42 antibody - middle region; anti-RBM42 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RPRPPRPEPPPGLMALEVPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPS
Sequence Length
480
Applicable Applications for anti-RBM42 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RBM42
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-RBM42 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-RBM42 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)
Related Product Information for anti-RBM42 antibody
This is a rabbit polyclonal antibody against RBM42. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: RBM42 belongs to the RRM RBM42 family and it contains 1 RRM (RNA recognition motif) domain. The functions of RBM42 remain unknown.
Target Description: RBM42 belongs to the RRM RBM42 family and it contains 1 RRM (RNA recognition motif) domain. The functions of RBM42 remain unknown.
Product Categories/Family for anti-RBM42 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
RNA-binding protein 42 isoform 1
NCBI Official Synonym Full Names
RNA binding motif protein 42
NCBI Official Symbol
RBM42
NCBI Protein Information
RNA-binding protein 42
UniProt Protein Name
RNA-binding protein 42
Protein Family
UniProt Gene Name
RBM42
UniProt Entry Name
RBM42_HUMAN
Uniprot Description
Function: Binds (via the RRM domain) to the 3'-untranslated region (UTR) of CDKN1A mRNA
By similarity.
Subunit structure: Interacts with HNRNPK
By similarity.
Subcellular location: Nucleus
By similarity. Cytoplasm
By similarity. Note: Upon stress response, localizes with HNRNPK in cytoplasmic aggregates of stalled translational preinitiation complexes called stress granules
By similarity.
Sequence similarities: Belongs to the RRM RBM42 family.Contains 1 RRM (RNA recognition motif) domain.
Sequence caution: The sequence AAB57629.1 differs from that shown. Reason: Erroneous gene model prediction.
Research Articles on RBM42
Similar Products
Product Notes
The RBM42 rbm42 (Catalog #AAA3205593) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBM42 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RBM42 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RBM42 rbm42 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RPRPPRPEPP PGLMALEVPE PLGEDKKKGK PEKLKRCIRT AAGSSWEDPS. It is sometimes possible for the material contained within the vial of "RBM42, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
