Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RBM14 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Rabbit RBM14 Polyclonal Antibody | anti-RBM14 antibody

RBM14 antibody - N-terminal region

Gene Names
RBM14; SIP; COAA; PSP2; SYTIP1; TMEM137
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RBM14; Polyclonal Antibody; RBM14 antibody - N-terminal region; anti-RBM14 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGD
Sequence Length
669
Applicable Applications for anti-RBM14 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RBM14
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RBM14 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-RBM14 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Related Product Information for anti-RBM14 antibody
This is a rabbit polyclonal antibody against RBM14. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RBM14 contains 2 RRM (RNA recognition motif) domains. Isoform 1 may function as a nuclear receptor coactivator, enhancing transcription through other coactivators such as NCOA6 and CITED1. Isoform 2, functions as a transcriptional repressor, modulating transcriptional activities of coactivators including isoform 1, NCOA6 and CITED1.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
RNA-binding protein 14 isoform 1
NCBI Official Synonym Full Names
RNA binding motif protein 14
NCBI Official Symbol
RBM14
NCBI Official Synonym Symbols
SIP; COAA; PSP2; SYTIP1; TMEM137
NCBI Protein Information
RNA-binding protein 14
UniProt Protein Name
RNA-binding protein 14
Protein Family
UniProt Gene Name
RBM14
UniProt Synonym Gene Names
SIP; PSP2; SYT-interacting protein
UniProt Entry Name
RBM14_HUMAN

NCBI Description

This gene encodes a ribonucleoprotein that functions as a general nuclear coactivator, and an RNA splicing modulator. This protein contains two RNA recognition motifs (RRM) at the N-terminus, and multiple hexapeptide repeat domain at the C-terminus that interacts with thyroid hormone receptor-binding protein (TRBP), and is required for transcription activation. Alternatively spliced transcript variants encoding different isoforms (with opposing effects on transcription) have been described for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

RBM14: an RNA binding protein and transcriptional regulator. Expressed in all tissues tested, including brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood lymphocytes. Two alternatively spliced isoforms have been observed. Isoform 1 may function as a nuclear receptor coactivator, enhancing transcription through other coactivators such as NCOA6 and CITED1. Isoform 2, functions as a transcriptional repressor, modulating transcriptional activities of coactivators including isoform 1, NCOA6 and CITED1.

Protein type: Nucleolus; RNA-binding; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 11q13.2

Cellular Component: nucleoplasm; transcription factor complex; nucleolus; Srb-mediator complex; ribonucleoprotein complex

Molecular Function: protein binding, bridging; protein binding; ligand-dependent nuclear receptor transcription coactivator activity; RNA binding; nucleotide binding

Biological Process: transcription from RNA polymerase II promoter; estrogen receptor signaling pathway; glucocorticoid receptor signaling pathway; response to hormone stimulus; histone deacetylation; positive regulation of transcription from RNA polymerase II promoter; DNA repair; DNA replication; DNA recombination

Research Articles on RBM14

Similar Products

Product Notes

The RBM14 rbm14 (Catalog #AAA3205376) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBM14 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RBM14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RBM14 rbm14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YAFVHMEKEA DAKAAIAQLN GKEVKGKRIN VELSTKGQKK GPGLAVQSGD. It is sometimes possible for the material contained within the vial of "RBM14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.