Western Blot (WB)
(RBJ antibody (MBS5301447) used at 1 ug/ml to detect target protein.)
Rabbit RBJ Polyclonal Antibody | anti-RBJ antibody
RBJ antibody
Gene Names
Dnajc27; Rbj
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
RBJ; Polyclonal Antibody; RBJ antibody; Polyclonal RBJ; Anti-RBJ; Rab And Dnaj Domain Containing; RabJS; DKFZp434N211; anti-RBJ antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
RBJ antibody was raised against the middle region of RBJ
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBJ antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
272
Applicable Applications for anti-RBJ antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of RBJ protein has not been widely studied, and is yet to be fully elucidated.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
RBJ antibody was raised using the middle region of RBJ corresponding to a region with amino acids CVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKR
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(RBJ antibody (MBS5301447) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(RBJ antibody (MBS5301447) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-RBJ antibody
Rabbit polyclonal RBJ antibody raised against the middle region of RBJ
Product Categories/Family for anti-RBJ antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
31 kDa (MW of target protein)
NCBI Official Full Name
RBJ protein, partial
NCBI Official Synonym Full Names
DnaJ (Hsp40) homolog, subfamily C, member 27
NCBI Official Symbol
Dnajc27
NCBI Official Synonym Symbols
Rbj
NCBI Protein Information
dnaJ homolog subfamily C member 27
UniProt Protein Name
DnaJ homolog subfamily C member 27
UniProt Gene Name
Dnajc27
UniProt Synonym Gene Names
Rbj
UniProt Entry Name
DJC27_RAT
Uniprot Description
GTPase which can activate the MEK/ERK pathway and induce cell transformation when overexpressed. May act as a nuclear scaffold for MAPK1, probably by association with MAPK1 nuclear export signal leading to enhanced ERK1/ERK2 signaling.
Similar Products
Product Notes
The RBJ dnajc27 (Catalog #AAA5301447) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBJ antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RBJ can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the RBJ dnajc27 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RBJ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
