Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RARB expression in transfected 293T cell line by RARB polyclonal antibody. Lane 1: RARB transfected lysate (50.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human RARB Polyclonal Antibody | anti-RARB antibody

RARB (HAP, NR1B2, Retinoic Acid Receptor beta, RAR-beta, HBV-activated Protein, Nuclear Receptor Subfamily 1 Group B Member 2, RAR-epsilon) (HRP)

Gene Names
RARB; HAP; RRB2; NR1B2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RARB; Polyclonal Antibody; RARB (HAP; NR1B2; Retinoic Acid Receptor beta; RAR-beta; HBV-activated Protein; Nuclear Receptor Subfamily 1 Group B Member 2; RAR-epsilon) (HRP); anti-RARB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RARB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-RARB antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human RARB, aa1-448 (NP_000956.2).
Immunogen Sequence
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RARB expression in transfected 293T cell line by RARB polyclonal antibody. Lane 1: RARB transfected lysate (50.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RARB expression in transfected 293T cell line by RARB polyclonal antibody. Lane 1: RARB transfected lysate (50.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-RARB antibody
This gene encodes retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. The gene was first identified in a hepatocellular carcinoma where it flanks a hepatitis B virus integration site. The gene expresses at least two transcript variants; one additional transcript has been described, but its full length nature has not been determined. [provided by RefSeq].
Product Categories/Family for anti-RARB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,489 Da
NCBI Official Full Name
retinoic acid receptor beta isoform 1
NCBI Official Synonym Full Names
retinoic acid receptor, beta
NCBI Official Symbol
RARB
NCBI Official Synonym Symbols
HAP; RRB2; NR1B2
NCBI Protein Information
retinoic acid receptor beta; RAR-beta; RAR-epsilon; HBV-activated protein; retinoic acid receptor beta 2; retinoic acid receptor beta 4; retinoic acid receptor beta 5; hepatitis B virus activated protein; retinoic acid receptor beta variant 1; retinoic ac
UniProt Protein Name
Retinoic acid receptor beta
Protein Family
UniProt Gene Name
RARB
UniProt Synonym Gene Names
HAP; NR1B2; RAR-beta
UniProt Entry Name
RARB_HUMAN

NCBI Description

This gene encodes retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. The gene was first identified in a hepatocellular carcinoma where it flanks a hepatitis B virus integration site. The gene expresses at least two transcript variants; one additional transcript has been described, but its full length nature has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

RARB: is a receptor for retinoic acid, a potent mammalian morphogen and teratogen that has profound effects on vertebrate development. RARB is a member of the nuclear receptor superfamily. Controls cell function by directly regulating gene expression. Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal steroid-binding domain. Four splice-variant isoforms have been described. Isoform beta-1 and beta-2 are nuclear and isoform beta-4 cytoplasmic.

Protein type: Motility/polarity/chemotaxis; Nuclear receptor; Oncoprotein

Chromosomal Location of Human Ortholog: 3p24.2

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: retinoid X receptor binding; protein binding; DNA binding; zinc ion binding; protein complex binding; steroid hormone receptor activity; drug binding; retinoic acid receptor activity

Biological Process: retinoic acid receptor signaling pathway; transcription initiation from RNA polymerase II promoter; regulation of myelination; striatum development; glandular epithelial cell development; positive regulation of apoptosis; embryonic eye morphogenesis; multicellular organism growth; negative regulation of chondrocyte differentiation; ventricular cardiac muscle cell differentiation; negative regulation of transcription from RNA polymerase II promoter; signal transduction; embryonic hindlimb morphogenesis; negative regulation of cell proliferation; ureteric bud development; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; gene expression; steroid hormone mediated signaling; positive regulation of neuron differentiation; transmembrane transport; embryonic gut development; negative regulation of apoptosis

Disease: Microphthalmia, Syndromic 12

Research Articles on RARB

Similar Products

Product Notes

The RARB rarb (Catalog #AAA6392005) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RARB (HAP, NR1B2, Retinoic Acid Receptor beta, RAR-beta, HBV-activated Protein, Nuclear Receptor Subfamily 1 Group B Member 2, RAR-epsilon) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RARB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RARB rarb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RARB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.