Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-RAD51 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit RAD51 Polyclonal Antibody | anti-RAD51 antibody

RAD51 Antibody - N-terminal region

Gene Names
RAD51; RECA; BRCC5; FANCR; MRMV2; HRAD51; RAD51A; HsRad51; HsT16930
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RAD51; Polyclonal Antibody; RAD51 Antibody - N-terminal region; anti-RAD51 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYA
Sequence Length
339
Applicable Applications for anti-RAD51 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 94%; Human: 100%; Mouse: 100%; Rabbit: 94%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RAD51
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-RAD51 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-RAD51 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: RabbitTarget Name: RAD51Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RAD51Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RAD51 antibody
This is a rabbit polyclonal antibody against RAD51. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
DNA repair protein RAD51 homolog 1 isoform 2
NCBI Official Synonym Full Names
RAD51 recombinase
NCBI Official Symbol
RAD51
NCBI Official Synonym Symbols
RECA; BRCC5; FANCR; MRMV2; HRAD51; RAD51A; HsRad51; HsT16930
NCBI Protein Information
DNA repair protein RAD51 homolog 1
UniProt Protein Name
DNA repair protein RAD51 homolog 1
Protein Family
UniProt Gene Name
RAD51
UniProt Synonym Gene Names
RAD51A; RECA; HsRAD51; hRAD51
UniProt Entry Name
RAD51_HUMAN

NCBI Description

The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009]

Uniprot Description

RAD51: a member of the RAD51 protein family. Involved in the homologous recombination and repair of DNA. Interacts with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. Interacts with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both its intracellular localization and DNA-binding ability. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Defects in RAD51 are associated with breast cancer. Two alternatively spliced isoforms have been reported.

Protein type: DNA repair, damage; Mitochondrial

Chromosomal Location of Human Ortholog: 15q15.1

Cellular Component: nuclear chromosome; PML body; condensed nuclear chromosome; mitochondrion; condensed chromosome; nucleoplasm; lateral element; mitochondrial matrix; perinuclear region of cytoplasm; cytoplasm; nucleolus; microtubule organizing center; nucleus

Molecular Function: protein C-terminus binding; identical protein binding; protein binding; double-stranded DNA binding; damaged DNA binding; single-stranded DNA binding; ATP binding; single-stranded DNA-dependent ATPase activity

Biological Process: DNA unwinding during replication; meiosis; mitotic recombination; DNA recombinase assembly; meiotic recombination; double-strand break repair; positive regulation of DNA ligation; DNA repair; response to DNA damage stimulus; double-strand break repair via homologous recombination; protein homooligomerization; DNA recombination

Disease: Breast Cancer; Mirror Movements 2

Research Articles on RAD51

Similar Products

Product Notes

The RAD51 rad51 (Catalog #AAA3200568) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAD51 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RAD51 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAD51 rad51 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QLEANADTSV EEESFGPQPI SRLEQCGINA NDVKKLEEAG FHTVEAVAYA. It is sometimes possible for the material contained within the vial of "RAD51, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.