Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RAD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: COLO205 cell lysateRAD1 is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells)

Rabbit RAD1 Polyclonal Antibody | anti-RAD1 antibody

RAD1 antibody - middle region

Gene Names
RAD1; REC1; HRAD1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RAD1; Polyclonal Antibody; RAD1 antibody - middle region; anti-RAD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNQTQVNRYKISLL
Sequence Length
282
Applicable Applications for anti-RAD1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RAD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RAD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: COLO205 cell lysateRAD1 is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells)

Western Blot (WB) (WB Suggested Anti-RAD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: COLO205 cell lysateRAD1 is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells)
Related Product Information for anti-RAD1 antibody
This is a rabbit polyclonal antibody against RAD1. It was validated on Western Blot

Target Description: This gene encodes a component of a heterotrimeric cell cycle checkpoint complex, known as the 9-1-1 complex, that is activated to stop cell cycle progression in response to DNA damage or incomplete DNA replication. The 9-1-1 complex is recruited by RAD17 to affected sites where it may attract specialized DNA polymerases and other DNA repair effectors. Alternatively spliced transcript variants of this gene have been described.
Product Categories/Family for anti-RAD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
cell cycle checkpoint protein RAD1
NCBI Official Synonym Full Names
RAD1 checkpoint DNA exonuclease
NCBI Official Symbol
RAD1
NCBI Official Synonym Symbols
REC1; HRAD1
NCBI Protein Information
cell cycle checkpoint protein RAD1
UniProt Protein Name
Cell cycle checkpoint protein RAD1
Protein Family
UniProt Gene Name
RAD1
UniProt Synonym Gene Names
REC1; hRAD1
UniProt Entry Name
RAD1_HUMAN

NCBI Description

This gene encodes a component of a heterotrimeric cell cycle checkpoint complex, known as the 9-1-1 complex, that is activated to stop cell cycle progression in response to DNA damage or incomplete DNA replication. The 9-1-1 complex is recruited by RAD17 to affected sites where it may attract specialized DNA polymerases and other DNA repair effectors. Alternatively spliced transcript variants of this gene have been described. [provided by RefSeq, Jan 2009]

Uniprot Description

RAD1: Component of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesion upon damage by the RAD17-replication factor C (RFC) clamp loader complex. Acts then as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair (LP-BER). The 9-1-1 complex stimulates DNA polymerase beta (POLB) activity by increasing its affinity for the 3'-OH end of the primer-template and stabilizes POLB to those sites where LP-BER proceeds; endonuclease FEN1 cleavage activity on substrates with double, nick, or gap flaps of distinct sequences and lengths; and DNA ligase I (LIG1) on long-patch base excision repair substrates. The 9-1-1 complex is necessary for the recruitment of RHNO1 to sites of double-stranded breaks (DSB) occurring during the S phase. Isoform 1 possesses 3'->5' double stranded DNA exonuclease activity. Belongs to the rad1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; DNA repair, damage; Deoxyribonuclease; EC 3.1.11.2

Chromosomal Location of Human Ortholog: 5p13.2

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; chromosome; nucleus

Molecular Function: protein binding; exodeoxyribonuclease III activity; damaged DNA binding; 3'-5' exonuclease activity

Biological Process: meiotic recombination checkpoint; substantia nigra development; DNA damage checkpoint; DNA repair; DNA catabolic process, exonucleolytic; DNA replication; response to DNA damage stimulus

Research Articles on RAD1

Similar Products

Product Notes

The RAD1 rad1 (Catalog #AAA3213520) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAD1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RAD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAD1 rad1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ITMSPDKPYF RLSTFGNAGS SHLDYPKDSD LMEAFHCNQT QVNRYKISLL. It is sometimes possible for the material contained within the vial of "RAD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.