Western Blot (WB)
(WB Suggested Anti-RAB6C AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Thymus)
Rabbit RAB6C Polyclonal Antibody | anti-RAB6C antibody
RAB6C Antibody - C-terminal region
Gene Names
RAB6C; WTH3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RAB6C; Polyclonal Antibody; RAB6C Antibody - C-terminal region; anti-RAB6C antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YNVKQLFRRVAAALPGMESTQDGSREDMSDIKLEKPQEQTVSEGGCSCYS
Sequence Length
254
Applicable Applications for anti-RAB6C antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB6C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-RAB6C AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Thymus)
Western Blot (WB)
(WB Suggested Anti-RAB6C AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Thymus)
Related Product Information for anti-RAB6C antibody
This is a rabbit polyclonal antibody against RAB6C. It was validated on Western Blot
Target Description: The function remains unknown.
Target Description: The function remains unknown.
Product Categories/Family for anti-RAB6C antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
ras-related protein Rab-6C
NCBI Official Synonym Full Names
RAB6C, member RAS oncogene family
NCBI Official Symbol
RAB6C
NCBI Official Synonym Symbols
WTH3
NCBI Protein Information
ras-related protein Rab-6C
UniProt Protein Name
Ras-related protein Rab-6C
Protein Family
UniProt Gene Name
RAB6C
UniProt Synonym Gene Names
WTH3
UniProt Entry Name
RAB6C_HUMAN
Uniprot Description
RAB6C: May be involved in the regulation of centrosome duplication and cell cycle progression. Belongs to the small GTPase superfamily. Rab family.
Protein type: G protein, monomeric, Rab; G protein, monomeric; G protein
Chromosomal Location of Human Ortholog: 2q21.1
Cellular Component: Golgi apparatus; centrosome; intracellular; nucleus
Molecular Function: GTPase activity; GDP binding; GTP binding
Biological Process: response to drug; intra-Golgi vesicle-mediated transport; intracellular protein transport; metabolic process; small GTPase mediated signal transduction; retrograde vesicle-mediated transport, Golgi to ER; cell cycle process; Rab protein signal transduction; retrograde transport, endosome to Golgi
Research Articles on RAB6C
Similar Products
Product Notes
The RAB6C rab6c (Catalog #AAA3214818) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB6C Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RAB6C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAB6C rab6c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YNVKQLFRRV AAALPGMEST QDGSREDMSD IKLEKPQEQT VSEGGCSCYS. It is sometimes possible for the material contained within the vial of "RAB6C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
