Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RAB3CAntibody Dilution: 1.0ug/mlSample Type: THP-1 cell lysate)

Rabbit RAB3C Polyclonal Antibody | anti-RAB3C antibody

RAB3C antibody - C-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RAB3C; Polyclonal Antibody; RAB3C antibody - C-terminal region; anti-RAB3C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDII
Sequence Length
227
Applicable Applications for anti-RAB3C antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RAB3CAntibody Dilution: 1.0ug/mlSample Type: THP-1 cell lysate)

Western Blot (WB) (Host: RabbitTarget Name: RAB3CAntibody Dilution: 1.0ug/mlSample Type: THP-1 cell lysate)
Related Product Information for anti-RAB3C antibody
This is a rabbit polyclonal antibody against RAB3C. It was validated on Western Blot

Target Description: RAB proteins, such as RAB3C, are small GTPases implicated in the regulation of vesicular trafficking between membrane compartments.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
ras-related protein Rab-3C isoform 1
NCBI Official Synonym Full Names
RAB3C, member RAS oncogene family
NCBI Official Symbol
RAB3C
NCBI Protein Information
ras-related protein Rab-3C
UniProt Protein Name
Ras-related protein Rab-3C
Protein Family
UniProt Gene Name
RAB3C
UniProt Entry Name
RAB3C_HUMAN

NCBI Description

This gene is a member of the RAS oncogene family and encodes a small GTPase. Other similar small GTPases are known to be involved in vesicle trafficking, and the encoded protein was shown to play a role in recycling phagocytosed MHC class 1 complexes to the cell surface. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]

Uniprot Description

RAB3C: Protein transport. Probably involved in vesicular traffic. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein; G protein, monomeric, Rab; G protein, monomeric

Chromosomal Location of Human Ortholog: 5q13

Cellular Component: synaptic vesicle; secretory granule membrane; perinuclear region of cytoplasm; plasma membrane; cytosol; vesicle; endosome

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding; myosin V binding

Biological Process: regulation of exocytosis; intracellular protein transport; antigen processing and presentation; synaptic vesicle exocytosis; metabolic process; protein secretion; Rab protein signal transduction; vesicle docking during exocytosis

Research Articles on RAB3C

Similar Products

Product Notes

The RAB3C rab3c (Catalog #AAA3216382) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB3C antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RAB3C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAB3C rab3c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GNKCDMEDER VISTERGQHL GEQLGFEFFE TSAKDNINVK QTFERLVDII. It is sometimes possible for the material contained within the vial of "RAB3C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.