Western Blot (WB)
(Western Blot analysis of RAB3B expression in transfected 293T cell line by RAB3B polyclonal antibody. Lane 1: RAB3B transfected lysate (24.8kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human RAB3B Polyclonal Antibody | anti-RAB3B antibody
RAB3B (Ras-related Protein Rab-3B)
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
RAB3B; Polyclonal Antibody; RAB3B (Ras-related Protein Rab-3B); Anti -RAB3B (Ras-related Protein Rab-3B); anti-RAB3B antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RAB3B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MASVTDGKTGVKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTPPLLQQNCSC
Applicable Applications for anti-RAB3B antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human RAB3B, aa1-219 (NP_002858.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of RAB3B expression in transfected 293T cell line by RAB3B polyclonal antibody. Lane 1: RAB3B transfected lysate (24.8kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of RAB3B expression in transfected 293T cell line by RAB3B polyclonal antibody. Lane 1: RAB3B transfected lysate (24.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-RAB3B antibody
Protein transport. It probably is involved in vesicular traffic (By similarity).
Product Categories/Family for anti-RAB3B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
24,758 Da
NCBI Official Full Name
RAB3B, member RAS oncogene family
NCBI Official Synonym Full Names
RAB3B, member RAS oncogene family
NCBI Official Symbol
RAB3B
NCBI Protein Information
ras-related protein Rab-3B; brain antigen RAB3B
UniProt Protein Name
Ras-related protein Rab-3B
Protein Family
UniProt Gene Name
RAB3B
UniProt Entry Name
RAB3B_HUMAN
Uniprot Description
RAB3B: Protein transport. Probably involved in vesicular traffic. Belongs to the small GTPase superfamily. Rab family.
Protein type: G protein, monomeric, Rab; G protein, monomeric; G protein
Chromosomal Location of Human Ortholog: 1p32-p31
Cellular Component: synaptic vesicle; perinuclear region of cytoplasm; secretory granule membrane; cytoplasm; plasma membrane; cytosol; vesicle; endosome
Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding; myosin V binding
Biological Process: regulation of exocytosis; intracellular protein transport; antigen processing and presentation; synaptic vesicle exocytosis; positive regulation of dopamine uptake; protein secretion; peptidyl-cysteine methylation; Rab protein signal transduction; vesicle docking during exocytosis
Research Articles on RAB3B
Similar Products
Product Notes
The RAB3B rab3b (Catalog #AAA643380) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAB3B (Ras-related Protein Rab-3B) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAB3B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the RAB3B rab3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASVTDGKTG VKDASDQNFD YMFKLLIIGN SSVGKTSFLF RYADDTFTPA FVSTVGIDFK VKTVYRHEKR VKLQIWDTAG QERYRTITTA YYRGAMGFIL MYDITNEESF NAVQDWATQI KTYSWDNAQV ILVGNKCDME EERVVPTEKG QLLAEQLGFD FFEASAKENI SVRQAFERLV DAICDKMSDS LDTDPSMLGS SKNTRLSDTP PLLQQNCSC. It is sometimes possible for the material contained within the vial of "RAB3B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
