Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RAB32Sample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human RAB32 Polyclonal Antibody | anti-RAB32 antibody

RAB32 Antibody - middle region

Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RAB32; Polyclonal Antibody; RAB32 Antibody - middle region; anti-RAB32 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVG
Sequence Length
225
Applicable Applications for anti-RAB32 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of human RAB32
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RAB32Sample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RAB32Sample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RAB32 antibody
The protein encoded by this gene anchors the type II regulatory subunit of protein kinase A to the mitochondrion and aids in mitochondrial fission. The encoded protein also appears to be involved in autophagy and melanosome secretion. Variations in this gene may be linked to leprosy.
Product Categories/Family for anti-RAB32 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24 kDa
NCBI Official Full Name
ras-related protein Rab-32
NCBI Official Synonym Full Names
RAB32, member RAS oncogene family
NCBI Official Symbol
RAB32
NCBI Protein Information
ras-related protein Rab-32
UniProt Protein Name
Ras-related protein Rab-32
Protein Family
UniProt Gene Name
RAB32
UniProt Entry Name
RAB32_HUMAN

NCBI Description

The protein encoded by this gene anchors the type II regulatory subunit of protein kinase A to the mitochondrion and aids in mitochondrial fission. The encoded protein also appears to be involved in autophagy and melanosome secretion. Variations in this gene may be linked to leprosy. [provided by RefSeq, Dec 2015]

Uniprot Description

RAB32: Acts as an A-kinase anchoring protein by binding to the type II regulatory subunit of protein kinase A and anchoring it to the mitochondrion. Also involved in synchronization of mitochondrial fission. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein, monomeric; G protein; G protein, monomeric, Rab

Chromosomal Location of Human Ortholog: 6q24.3

Cellular Component: phagocytic vesicle membrane; mitochondrion; membrane; early endosome; melanosome; phagocytic vesicle; trans-Golgi network

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding; GTP-dependent protein binding

Biological Process: intracellular protein transport; antigen processing and presentation; metabolic process; Rab protein signal transduction

Research Articles on RAB32

Similar Products

Product Notes

The RAB32 rab32 (Catalog #AAA3222499) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB32 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAB32 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAB32 rab32 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QHYRATIGVD FALKVLNWDS RTLVRLQLWD IAGQERFGNM TRVYYKEAVG. It is sometimes possible for the material contained within the vial of "RAB32, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.