Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RAB2A antibody - C-terminal region validated by WB using HepG2 cell lysate at 1ug/ml.)

Rabbit RAB2A Polyclonal Antibody | anti-RAB2A antibody

RAB2A antibody - C-terminal region

Gene Names
RAB2A; LHX; RAB2
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RAB2A; Polyclonal Antibody; RAB2A antibody - C-terminal region; anti-RAB2A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NTAKEIYEKIQEGVFDINNEANGIKIGPQHAATNATHAGNQGGQQAGGGC
Sequence Length
212
Applicable Applications for anti-RAB2A antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(RAB2A antibody - C-terminal region validated by WB using HepG2 cell lysate at 1ug/ml.)

Western Blot (WB) (RAB2A antibody - C-terminal region validated by WB using HepG2 cell lysate at 1ug/ml.)

Western Blot (WB)

(Sample Type: 1. Human Cervical Cancer Cell Lysate (15ug)2. Monkey Fibroblast Cell Lysate (15ug)3. Human Cervical Cancer Cell transfected with mouse Rab2A-GFP (15ug)Primary Dilution: 1:1000Secondary Antibody: goat anti-RabbitSecondary Dilution: 1:40,000Image Submitted by: Dr. Jakob Szwedo, Dr. Lupashin's LabUniversity of Arkansas for Medical Sciences)

Western Blot (WB) (Sample Type: 1. Human Cervical Cancer Cell Lysate (15ug)2. Monkey Fibroblast Cell Lysate (15ug)3. Human Cervical Cancer Cell transfected with mouse Rab2A-GFP (15ug)Primary Dilution: 1:1000Secondary Antibody: goat anti-RabbitSecondary Dilution: 1:40,000Image Submitted by: Dr. Jakob Szwedo, Dr. Lupashin's LabUniversity of Arkansas for Medical Sciences)
Related Product Information for anti-RAB2A antibody
This is a rabbit polyclonal antibody against RAB2A. It was validated on Western Blot

Target Description: Members of the Rab protein family are nontransforming monomeric GTP-binding proteins of the Ras superfamily that contain 4 highly conserved regions involved in GTP binding and hydrolysis. Rabs are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking. The mammalian RAB proteins show striking similarities to the S. cerevisiae YPT1 and SEC4 proteins, Ras-related GTP-binding proteins involved in the regulation of secretion.
Product Categories/Family for anti-RAB2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
ras-related protein Rab-2A isoform a
NCBI Official Synonym Full Names
RAB2A, member RAS oncogene family
NCBI Official Symbol
RAB2A
NCBI Official Synonym Symbols
LHX; RAB2
NCBI Protein Information
ras-related protein Rab-2A
UniProt Protein Name
Ras-related protein Rab-2A
Protein Family
UniProt Gene Name
RAB2A
UniProt Synonym Gene Names
RAB2
UniProt Entry Name
RAB2A_HUMAN

NCBI Description

The protein encoded by this gene belongs to the Rab family, members of which are small molecular weight guanosine triphosphatases (GTPases) that contain highly conserved domains involved in GTP binding and hydrolysis. The Rabs are membrane-bound proteins, involved in vesicular fusion and trafficking. This protein is a resident of pre-Golgi intermediates, and is required for protein transport from the endoplasmic reticulum (ER) to the Golgi complex. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

Rab2: Required for protein transport from the endoplasmic reticulum to the Golgi complex. Belongs to the small GTPase superfamily. Rab family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: G protein, monomeric, Rab; G protein, monomeric; G protein

Chromosomal Location of Human Ortholog: 8q12.1

Cellular Component: Golgi membrane; endoplasmic reticulum membrane; ER-Golgi intermediate compartment membrane; lysosomal membrane; melanosome; nucleus

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding

Biological Process: intracellular protein transport; ER to Golgi vesicle-mediated transport; metabolic process; mitotic cell cycle; Rab protein signal transduction; Golgi organization and biogenesis

Research Articles on RAB2A

Similar Products

Product Notes

The RAB2A rab2a (Catalog #AAA3215236) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAB2A antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RAB2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAB2A rab2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NTAKEIYEKI QEGVFDINNE ANGIKIGPQH AATNATHAGN QGGQQAGGGC. It is sometimes possible for the material contained within the vial of "RAB2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.