Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- Rab18 Picoband antibody, MBS177784, Western blottingAll lanes: Anti Rab18 (MBS177784) at 0.5ug/mlLane 1: Rat Testis Tissue Lysate at 50ugLane 2: Rat Lung Tissue Lysate at 50ugLane 3: 293T Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 23KDObserved bind size: 23KD )

anti-Human, Rat Rab18 Polyclonal Antibody | anti-RAB18 antibody

Anti-Rab18 Antibody

Gene Names
RAB18; WARBM3; RAB18LI1
Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Rab18; Polyclonal Antibody; Anti-Rab18 Antibody; Ras-related protein Rab-18; AA959686; RAB18; RAB18 small GTPase; member RAS oncogene family; RAB18_HUMAN; RAB18LI1; Ras related protein Rab 18; Ras-asssociated protein RAB18; RP11-148B2.1; WARBM3; anti-RAB18 antibody
Ordering
For Research Use Only!
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
235
Applicable Applications for anti-RAB18 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Rab18 (156-192aa DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREE), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Rab18 Picoband antibody, MBS177784, Western blottingAll lanes: Anti Rab18 (MBS177784) at 0.5ug/mlLane 1: Rat Testis Tissue Lysate at 50ugLane 2: Rat Lung Tissue Lysate at 50ugLane 3: 293T Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 23KDObserved bind size: 23KD )

Western Blot (WB) (Anti- Rab18 Picoband antibody, MBS177784, Western blottingAll lanes: Anti Rab18 (MBS177784) at 0.5ug/mlLane 1: Rat Testis Tissue Lysate at 50ugLane 2: Rat Lung Tissue Lysate at 50ugLane 3: 293T Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 23KDObserved bind size: 23KD )
Related Product Information for anti-RAB18 antibody
Description: Rabbit IgG polyclonal antibody for Ras-related protein Rab-18(RAB18) detection. Tested with WB in Human;Rat.

Background: Ras-related protein Rab-18 is a protein that in humans is encoded by the RAB18 gene. It is a ubiquitously expressed protein with particularly high expression in the brain. The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies in zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene.
References
1. "Entrez Gene: RAB18 RAB18, member RAS oncogene family". 2. Lütcke A, Parton RG, Murphy C, Olkkonen VM, Dupree P, Valencia A, Simons K, Zerial M (December 1994). "Cloning and subcellular localization of novel rab proteins reveals polarized and cell type-specific expression". J. Cell. Sci. 107 (12): 3437-48. 3. Schafer U, Seibold S, Schneider A, Neugebauer E (Feb 2000). "Isolation and characterisation of the human rab18 gene after stimulation of endothelial cells with histamine". FEBS Lett 466 (1): 148-54.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,508 Da
NCBI Official Full Name
ras-related protein Rab-18 isoform 2
NCBI Official Synonym Full Names
RAB18, member RAS oncogene family
NCBI Official Symbol
RAB18
NCBI Official Synonym Symbols
WARBM3; RAB18LI1
NCBI Protein Information
ras-related protein Rab-18
UniProt Protein Name
Ras-related protein Rab-18
Protein Family
UniProt Gene Name
RAB18
UniProt Entry Name
RAB18_HUMAN

NCBI Description

The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies is zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

RAB18: a small G protein that plays a role in apical endocytosis/recycling. May be involved in transport between the plasma membrane and early endosomes.

Protein type: G protein, monomeric; G protein, monomeric, Rab; G protein

Chromosomal Location of Human Ortholog: 10p12.1

Cellular Component: cytosol; endoplasmic reticulum membrane; intracellular; plasma membrane

Molecular Function: GDP binding; GTP binding; GTPase activity; protein binding

Biological Process: brain development; eye development; intracellular protein transport; metabolic process; nucleocytoplasmic transport; small GTPase mediated signal transduction

Disease: Warburg Micro Syndrome 3

Research Articles on RAB18

Similar Products

Product Notes

The RAB18 rab18 (Catalog #AAA177784) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Rab18 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Rab18 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the RAB18 rab18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Rab18, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.