Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using QSOX2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Rabbit anti-Mouse QSOX2 Polyclonal Antibody | anti-QSOX2 antibody
QSOX2 Polyclonal Antibody
Gene Names
QSOX2; SOXN; QSCN6L1
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
QSOX2; Polyclonal Antibody; QSOX2 Polyclonal Antibody; QSCN6L1; SOXN; anti-QSOX2 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
VKKLLEMLQEWLASLPLDRIPYNAVLDLVNNKMRISGIFLTNHIKWVGCQGSRSELRGYPCSLWKLFHTLTVEASTHPDALVGTGFEDDPQAVLQTMRRYVHTFFGCKECGEHFEEMAKESMDSVKTPDQAILWLWKKHNMVNGRLAGHLSEDPRFPKLQWPTPDLCPACHEEIKGLASWDEGHVLTFLKQHYGRDNLLDTYSADQGDSSEGGTLARGEEEEKRLTPPEVSHGDRDTQSVRPPGALGPRPALPES
Sequence Length
698
Applicable Applications for anti-QSOX2 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human QSOX2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Membrane, Nucleus membrane, Secreted, Single-pass membrane protein
Positive Samples
Mouse pancreas, Mouse testis
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using QSOX2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using QSOX2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Product Categories/Family for anti-QSOX2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 77kDa
Observed: 85kDa
Observed: 85kDa
NCBI Official Full Name
sulfhydryl oxidase 2
NCBI Official Synonym Full Names
quiescin sulfhydryl oxidase 2
NCBI Official Symbol
QSOX2
NCBI Official Synonym Symbols
SOXN; QSCN6L1
NCBI Protein Information
sulfhydryl oxidase 2
UniProt Protein Name
Sulfhydryl oxidase 2
Protein Family
UniProt Gene Name
QSOX2
UniProt Synonym Gene Names
QSCN6L1; SOXN
NCBI Description
QSOX2 is a member of the sulfhydryl oxidase/quiescin-6 (Q6) family (QSOX1; MIM 603120) that regulates the sensitization of neuroblastoma cells for IFN-gamma (IFNG; MIM 147570)-induced cell death (Wittke et al., 2003 [PubMed 14633699]).[supplied by OMIM, Jun 2009]
Uniprot Description
Catalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides with the reduction of oxygen to hydrogen peroxide. May contribute to disulfide bond formation in a variety of secreted proteins. Also seems to play a role in regulating the sensitization of neuroblastoma cells for interferon-gamma-induced apoptosis.
Research Articles on QSOX2
Similar Products
Product Notes
The QSOX2 qsox2 (Catalog #AAA9135200) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The QSOX2 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's QSOX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the QSOX2 qsox2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VKKLLEMLQE WLASLPLDRI PYNAVLDLVN NKMRISGIFL TNHIKWVGCQ GSRSELRGYP CSLWKLFHTL TVEASTHPDA LVGTGFEDDP QAVLQTMRRY VHTFFGCKEC GEHFEEMAKE SMDSVKTPDQ AILWLWKKHN MVNGRLAGHL SEDPRFPKLQ WPTPDLCPAC HEEIKGLASW DEGHVLTFLK QHYGRDNLLD TYSADQGDSS EGGTLARGEE EEKRLTPPEV SHGDRDTQSV RPPGALGPRP ALPES. It is sometimes possible for the material contained within the vial of "QSOX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
