Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Pygm AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

Rabbit Pygm Polyclonal Antibody | anti-PYGM antibody

Pygm antibody - C-terminal region

Gene Names
Pygm; PG; AI115133
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Pygm; Polyclonal Antibody; Pygm antibody - C-terminal region; anti-PYGM antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEKI
Sequence Length
842
Applicable Applications for anti-PYGM antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Pygm AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

Western Blot (WB) (WB Suggested Anti-Pygm AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Related Product Information for anti-PYGM antibody
This is a rabbit polyclonal antibody against Pygm. It was validated on Western Blot

Target Description: Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties.
Product Categories/Family for anti-PYGM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97kDa
NCBI Official Full Name
glycogen phosphorylase, muscle form
NCBI Official Synonym Full Names
muscle glycogen phosphorylase
NCBI Official Symbol
Pygm
NCBI Official Synonym Symbols
PG; AI115133
NCBI Protein Information
glycogen phosphorylase, muscle form
UniProt Protein Name
Glycogen phosphorylase, muscle form
Protein Family
UniProt Gene Name
Pygm
UniProt Entry Name
PYGM_MOUSE

NCBI Description

This gene encodes a glycolysis enzyme found in muscle. Highly similar enzymes encoded by different genes are found in liver and brain. The encoded protein is involved in regulating the breakdown of glycogen to glucose-1-phosphate, which is necessary for ATP generation. [provided by RefSeq, Dec 2015]

Uniprot Description

PYGM: an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties. Dimers associate into a tetramer to form the enzymatically active phosphorylase A. Phosphorylation of Ser-14 converts phosphorylase B (unphosphorylated) to phosphorylase A.

Protein type: Phosphorylase; Transferase; Endoplasmic reticulum; Carbohydrate Metabolism - starch and sucrose; EC 2.4.1.1

Cellular Component: sarcoplasmic reticulum; cytoplasm; Z disc

Molecular Function: transferase activity; transferase activity, transferring glycosyl groups; glycogen phosphorylase activity; phosphorylase activity; nucleotide binding; drug binding; carbohydrate binding; catalytic activity; pyridoxal phosphate binding; AMP binding

Biological Process: cellular calcium ion homeostasis; glycogen metabolic process; response to organic substance; response to cAMP; glycogen catabolic process; metabolic process; carbohydrate metabolic process; response to hypoxia

Research Articles on PYGM

Similar Products

Product Notes

The PYGM pygm (Catalog #AAA3209118) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Pygm antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's Pygm can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PYGM pygm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KNPREWTRMV IRNIATSGKF SSDRTIAQYA REIWGVEPSR QRLPAPDEKI. It is sometimes possible for the material contained within the vial of "Pygm, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.