Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '11145'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
1.80 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '11145' and pd.language_id = 1
Query
Database
1.78 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '11145'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
1.91 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '11145'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '11145' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '11145'
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||0.5-200mg/L!!Sensitivity||0.29mg/L
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄⧉products_description => string (877) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Human GAG antibody. GAG present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Human GAG Antibody is added and binds to GAG in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated GAG antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Human GAG. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Human glycosaminoglycan (also known as GAG) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄products_references => string (3) "N/A"
$value['products_references']
⇄products_related_diseases => string (3) "N/A"
$value['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value['products_categories']
⇄products_search_terms => string (3) "N/A"
$value['products_search_terms']
⇄ncbi_full_name => string (3) "N/A"
$value['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value['sp_interactions']
⇄products_url => string (3) "N/A"
$value['products_url']
⇄products_viewed => string (1) "0"
$value['products_viewed']
⇄ncbi_summary_pdns => string (3) "N/A"
$value['ncbi_summary_pdns']
⇄sp_comments_pdns => string (3) "N/A"
$value['sp_comments_pdns']
⇄ncbi_research_articles_pdns => string (3) "N/A"
$value['ncbi_research_articles_pdns']
⇄products_description_extra => string (3) "N/A"
$value['products_description_extra']
title
Human glycosaminoglycan, GAG ELISA Kit | GAG elisa kit
datasheet
⧉⌕$value App\Libraries\DatasheetLibrary (10)
Properties (10)
Available methods (45)
⇄⧉public a -> array (75)
$value->a
⇄products_id_mbs => string (6) "161457"
$value->a['products_id_mbs']
⇄products_id => string (5) "11145"
$value->a['products_id']
⇄products_quantity => string (4) "9999"
$value->a['products_quantity']
⇄products_model => string (8) "AAA11145"
$value->a['products_model']
⇄products_model_oem => string (7) "E1409Hu"
$value->a['products_model_oem']
⇄products_similar => string (3) "N/A"
$value->a['products_similar']
⇄ncbi_gi_num => string (3) "N/A"
$value->a['ncbi_gi_num']
⇄ncbi_acc_num => string (3) "N/A"
$value->a['ncbi_acc_num']
⇄ncbi_acc_num_related => string (3) "N/A"
$value->a['ncbi_acc_num_related']
⇄ncbi_sp_acc_num_related => string (3) "N/A"
$value->a['ncbi_sp_acc_num_related']
⇄ncbi_gb_acc_num => string (3) "N/A"
$value->a['ncbi_gb_acc_num']
⇄sp_acc_num => string (3) "N/A"
$value->a['sp_acc_num']
⇄sp_acc_num_syn => string (3) "N/A"
$value->a['sp_acc_num_syn']
⇄products_image => string (9) "ELISA Kit"
$value->a['products_image']
⇄sequence_positions => string (3) "N/A"
$value->a['sequence_positions']
⇄sequence_length => string (3) "N/A"
$value->a['sequence_length']
⇄sequence => string (3) "N/A"
$value->a['sequence']
⇄clonality => string (3) "N/A"
$value->a['clonality']
⇄isotype => string (3) "N/A"
$value->a['isotype']
⇄clone_number => string (3) "N/A"
$value->a['clone_number']
⇄host => string (3) "N/A"
$value->a['host']
⇄reactivity => string (5) "Human"
$value->a['reactivity']
⇄specificity => string (3) "N/A"
$value->a['specificity']
⇄purity => string (3) "N/A"
$value->a['purity']
⇄form => string (3) "N/A"
$value->a['form']
⇄concentration => string (3) "N/A"
$value->a['concentration']
⇄storage_stability => string (38) "Store at 2 to 8 degree C for 6 months."
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||0.5-200mg/L!!Sensitivity||0.29mg/L
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value->a['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄⧉products_description => string (877) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value->a['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Human GAG antibody. GAG present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Human GAG Antibody is added and binds to GAG in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated GAG antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Human GAG. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Human glycosaminoglycan (also known as GAG) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄products_references => string (3) "N/A"
$value->a['products_references']
⇄products_related_diseases => string (3) "N/A"
$value->a['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value->a['products_categories']
⇄products_search_terms => string (3) "N/A"
$value->a['products_search_terms']
⇄ncbi_full_name => string (3) "N/A"
$value->a['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value->a['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value->a['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value->a['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value->a['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value->a['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value->a['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value->a['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value->a['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value->a['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value->a['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value->a['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value->a['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value->a['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value->a['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value->a['sp_interactions']
⇄products_url => string (3) "N/A"
$value->a['products_url']
⇄products_viewed => string (1) "0"
$value->a['products_viewed']
⇄ncbi_summary_pdns => string (3) "N/A"
$value->a['ncbi_summary_pdns']
⇄sp_comments_pdns => string (3) "N/A"
$value->a['sp_comments_pdns']
⇄ncbi_research_articles_pdns => string (3) "N/A"
$value->a['ncbi_research_articles_pdns']
⇄products_description_extra => string (3) "N/A"
$value->a['products_description_extra']
⇄⧉public d -> array (75)
$value->d
⇄products_id_mbs => string (6) "161457"
$value->d['products_id_mbs']
⇄products_id => string (5) "11145"
$value->d['products_id']
⇄products_quantity => string (4) "9999"
$value->d['products_quantity']
⇄products_model => string (8) "AAA11145"
$value->d['products_model']
⇄products_model_oem => string (7) "E1409Hu"
$value->d['products_model_oem']
⇄products_similar => string (3) "N/A"
$value->d['products_similar']
⇄ncbi_gi_num => string (3) "N/A"
$value->d['ncbi_gi_num']
⇄ncbi_acc_num => string (3) "N/A"
$value->d['ncbi_acc_num']
⇄ncbi_acc_num_related => string (3) "N/A"
$value->d['ncbi_acc_num_related']
⇄ncbi_sp_acc_num_related => string (3) "N/A"
$value->d['ncbi_sp_acc_num_related']
⇄ncbi_gb_acc_num => string (3) "N/A"
$value->d['ncbi_gb_acc_num']
⇄sp_acc_num => string (3) "N/A"
$value->d['sp_acc_num']
⇄sp_acc_num_syn => string (3) "N/A"
$value->d['sp_acc_num_syn']
⇄products_image => string (9) "ELISA Kit"
$value->d['products_image']
⇄sequence_positions => string (3) "N/A"
$value->d['sequence_positions']
⇄sequence_length => string (3) "N/A"
$value->d['sequence_length']
⇄sequence => string (3) "N/A"
$value->d['sequence']
⇄clonality => string (3) "N/A"
$value->d['clonality']
⇄isotype => string (3) "N/A"
$value->d['isotype']
⇄clone_number => string (3) "N/A"
$value->d['clone_number']
⇄host => string (3) "N/A"
$value->d['host']
⇄reactivity => string (5) "Human"
$value->d['reactivity']
⇄specificity => string (3) "N/A"
$value->d['specificity']
⇄purity => string (3) "N/A"
$value->d['purity']
⇄form => string (3) "N/A"
$value->d['form']
⇄concentration => string (3) "N/A"
$value->d['concentration']
⇄storage_stability => string (38) "Store at 2 to 8 degree C for 6 months."
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||0.5-200mg/L!!Sensitivity||0.29mg/L
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value->d['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄⧉products_description => string (877) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value->d['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Human GAG antibody. GAG present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Human GAG Antibody is added and binds to GAG in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated GAG antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Human GAG. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Human glycosaminoglycan (also known as GAG) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄products_references => string (3) "N/A"
$value->d['products_references']
⇄products_related_diseases => string (3) "N/A"
$value->d['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value->d['products_categories']
⇄products_search_terms => string (3) "N/A"
$value->d['products_search_terms']
⇄ncbi_full_name => string (3) "N/A"
$value->d['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value->d['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value->d['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value->d['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value->d['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value->d['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value->d['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value->d['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value->d['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value->d['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value->d['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value->d['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value->d['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value->d['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value->d['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value->d['sp_interactions']
⇄products_url => string (3) "N/A"
$value->d['products_url']
⇄products_viewed => string (1) "0"
$value->d['products_viewed']
⇄ncbi_summary_pdns => string (3) "N/A"
$value->d['ncbi_summary_pdns']
⇄sp_comments_pdns => string (3) "N/A"
$value->d['sp_comments_pdns']
⇄ncbi_research_articles_pdns => string (3) "N/A"
$value->d['ncbi_research_articles_pdns']
⇄products_description_extra => string (3) "N/A"
$value->d['products_description_extra']
⇄⧉public fields_below -> array (3)
$value->fields_below
⇄0 => string (31) "Related Product Information for"
⇄⧉specificity => string (373) "This assay has high sensitivity and excellent specificity for detection of G...
$value[0]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of GLY. No significant cross-reactivity or interference between GLY and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between GLY and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[0]['_source']['purity']
⇄form => string (3) "N/A"
$value[0]['_source']['form']
⇄concentration => string (3) "N/A"
$value[0]['_source']['concentration']
⇄storage_stability => string (34) "Store all reagents at 2-8 degree C"
Human glycosamionglycan ELISA Kit; glycosamionglycan; glycosamionglycan (Human)
⇄products_gene_name => string (3) "GAG"
$value[0]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[0]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1376) "Principle of the Assay: GLY ELISA kit applies the competitive enzyme immunoa...
$value[0]['_source']['products_description']
Principle of the Assay: GLY ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-GLY antibody and an GLY-HRP conjugate. The assay sample and buffer are incubated together with GLY-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the GLY concentration since GLY from samples and GLY-HRP conjugate compete for the anti-GLY antibody binding site. Since the number of sites is limited, as more sites are occupied by GLY from the sample, fewer sites are left to bind GLY-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The GLY concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This GLY ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human GLY. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄⧉search_terms => string (536) "aaa16534 human this assay has high sensitivity and excellent specificity for...
$value[0]['_source']['search_terms']
aaa16534 human this assay has high sensitivity and excellent specificity for detection of gags no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa16534_sc elisa kit glycosamionglycan gag 323916 samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative competitive 1.0 ng ml competitive1.0
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||0.5-200mg/L!!Sensitivity||0.29mg/L
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[1]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄⧉products_description => string (877) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value[1]['_source']['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Human GAG antibody. GAG present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Human GAG Antibody is added and binds to GAG in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated GAG antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Human GAG. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Human glycosaminoglycan (also known as GAG) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄products_references => string (3) "N/A"
$value[1]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[1]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[1]['_source']['products_categories']
⇄ncbi_full_name => string (3) "N/A"
$value[1]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[1]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[1]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[1]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[1]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[1]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[1]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value[1]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[1]['_source']['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value[1]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[1]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[1]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[1]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[1]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[1]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[1]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[1]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[1]['_source']['products_viewed']
⇄⧉search_terms => string (426) "aaa11145 human typical testing data standard curve for reference only aaa111...
$value[1]['_source']['search_terms']
aaa11145 human typical testing data standard curve for reference only aaa11145_sc elisa kit glycosaminoglycan gag samples serum plasma cell culture supernates lysates tissue homogenates assay type quantitative sandwich detection range 30ng l 7000ng sensitivity 16.39ng intra precision within an three of known concentration were tested on one plate to assess cv<8 inter between assays in separate cv = sd mean x 100 cv<10 x100
⇄⧉products_description => string (825) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[2]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Mouse GAG monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄products_references => string (3) "N/A"
$value[2]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[2]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[2]['_source']['products_categories']
⇄ncbi_full_name => string (3) "N/A"
$value[2]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[2]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[2]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[2]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[2]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[2]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[2]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value[2]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[2]['_source']['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value[2]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[2]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[2]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[2]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[2]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[2]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[2]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[2]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[2]['_source']['products_viewed']
⇄⧉search_terms => string (305) "aaa22768 mouse typical testing data standard curve for reference only aaa227...
$value[2]['_source']['search_terms']
aaa22768 mouse typical testing data standard curve for reference only aaa22768_sc elisa kit glycosaminoglycan gag samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 100 ng ml 1.56 sensitivity up to 0.5 intra precision <= 8 inter 12 range100 to0.5 <=8 inter12
⇄⧉specificity => string (169) "This assay has high sensitivity and excellent specificity for detection of G...
$value[3]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of GAGs. No significant cross-reactivity or interference between GAGs and analogues was observed.
⇄purity => string (3) "N/A"
$value[3]['_source']['purity']
⇄form => string (3) "N/A"
$value[3]['_source']['form']
⇄concentration => string (3) "N/A"
$value[3]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[3]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
Assay Type||Competitive!!Samples||Serum, plasma, tissue homogenates and other biological fluids!!Detection Range||1.563-100ng/ml!!Sensitivity||0.5ng/ml
⇄⧉products_description => string (840) "Principle of the Assay: This kit was based on Competitive-ELISA detection me...
$value[3]['_source']['products_description']
Principle of the Assay: This kit was based on Competitive-ELISA detection method. The microtiter plate provided in this kit has been pre-coated with target. During the reaction, target in the sample or standard competes with a fixed amount of target on the solid phase supporter for sites on the Biotinylated Detection Antibody specific to target. Excess conjugate and unbound sample or standard are washed from the plate, and HRP-Streptavidin (SABC) is added to each microplate well and incubated. Then TMB substrate solution is added to each well. The enzyme-substrate reaction is terminated by the addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm. The concentration of target in the samples is then determined by comparing the OD of the samples to the standard curve.
⇄products_references => string (3) "N/A"
$value[3]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[3]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[3]['_source']['products_categories']
⇄ncbi_full_name => string (3) "N/A"
$value[3]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[3]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[3]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[3]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[3]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[3]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[3]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value[3]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[3]['_source']['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value[3]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[3]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[3]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[3]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[3]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[3]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[3]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[3]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[3]['_source']['products_viewed']
⇄⧉search_terms => string (416) "aaa27527 rat this assay has high sensitivity and excellent specificity for d...
$value[3]['_source']['search_terms']
aaa27527 rat this assay has high sensitivity and excellent specificity for detection of gags no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa27527_sc elisa kit glycosaminoglycan samples serum plasma tissue homogenates other biological fluids type quantitative competitive range 1.563 100ng ml 0.5ng intra precision cv<8 inter cv<10
⇄specificity => string (75) "Specifically recognize GAGs, no obvious cross reaction with other analogues"
$value[4]['_source']['specificity']
⇄purity => string (3) "N/A"
$value[4]['_source']['purity']
⇄form => string (3) "N/A"
$value[4]['_source']['form']
⇄concentration => string (3) "N/A"
$value[4]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[4]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
Assay Type||Competitive!!Samples||Serum, plasma, cell culture supernatant and other biological samples!!Detection Range||1.563-100ng/ml!!Sensitivity||0.938ng/ml
⇄⧉etc_term2 => string (270) "Intra-assay Precision||Intra-assay Precision: samples with low, medium and h...
$value[4]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision: samples with low, medium and high concentration are tested 20 times on same plate.!!Inter-assay Precision||Inter-assay Precision: samples with low, medium and high concentration are tested 20 times on three different plates.
⇄⧉products_description => string (1316) "Background: Glycosaminoglycans are long unbranched polysaccharides which are...
$value[4]['_source']['products_description']
Background: Glycosaminoglycans are long unbranched polysaccharides which are composed of repeating disaccharide units and are also called GAGs or mucopolysaccharides due to their viscous and lubricating properties, just like in mucous secretions. Glycosaminoglycans play a vital role in cell signalling and development, angiogenesis, anticoagulation, tumour progression, axonal growth and metastasis.<br><br>Principle of the Assay: This kit was based on Competitive-ELISA detection method. The microtiter plate provided in this kit has been pre-coated with GAGs. During the reaction, GAGs in the sample or standard competes with a fixed amount of GAGs on the solid phase supporter for sites on the Biotinylated Detection Antibody specific to GAGs. Excess conjugate and unbound sample or standard are washed from the plate, and HRP-Streptavidin (SABC) is added to each microplate well and incubated. Then TMB substrate solution is added to each well. The enzymesubstrate reaction is terminated by the addition of a acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm. The concentration of GAGs in the samples is then determined by comparing the OD of the samples to the standard curve. The concentration of the target substance was inversely proportional to the OD450 value.
⇄products_references => string (3) "N/A"
$value[4]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[4]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[4]['_source']['products_categories']
⇄ncbi_full_name => string (3) "N/A"
$value[4]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[4]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[4]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[4]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[4]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[4]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[4]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value[4]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[4]['_source']['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value[4]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[4]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[4]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[4]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[4]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[4]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[4]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[4]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[4]['_source']['products_viewed']
⇄⧉search_terms => string (439) "aaa27534 human this assay has high sensitivity and excellent specificity for...
$value[4]['_source']['search_terms']
aaa27534 human this assay has high sensitivity and excellent specificity for detection of gags no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa27534_sc elisa kit glycosaminoglycan mucopolysaccharide samples serum plasma tissue homogenates other biological fluids type quantitative competitive range 1.563 100ng ml 0.938ng intra precision cv<8 inter cv<10
⇄⧉specificity => string (183) "This assay has high sensitivity and excellent specificity for detection of h...
$value[5]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human FOLH1. No significant cross-reactivity or interference between human FOLH1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[5]['_source']['purity']
⇄form => string (3) "N/A"
$value[5]['_source']['form']
⇄concentration => string (3) "N/A"
$value[5]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[5]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[5]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (735) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[5]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for FOLH1 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any FOLH1 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for FOLH1 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of FOLH1 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (878) "aaa18017 human this assay has high sensitivity and excellent specificity for...
$value[5]['_source']['search_terms']
aaa18017 human this assay has high sensitivity and excellent specificity for detection of folh1 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18017_td elisa kit folate hydrolase prostate specific membrane antigen 1 glutamate carboxypeptidase 2 fgcp folh gcp2 gcpii naalad1 naaladase psm psma mgcp n acetylated alpha linked acidic dipeptidase cell growth inhibiting protein 27 folylpoly gamma carboxypep isoform i carboxylase ii gene variant f pteroylpoly 84,331 da gig27 folh1_human 62548858 np_001014986.1 q04609 nm_001014986.1 o43748 q16305 q541a4 q8tay3 q9np15 a4uu12 a9cb79 b7z312 b7z343 d3dqs5 e9pdx8 600934 samples serum plasma tissue homogenates type quantitative sandwich range 4.7 ng ml 300 < 1.2 intra precision within an cv antigen1 carboxypeptidase2 protein27 range4.7 ml300 <1.2
⇄⧉specificity => string (176) "This assay has high sensitivity and excellent specificity for detection of M...
$value[6]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of MCP/CD46. No significant crossreactivity or interference between MCP/CD46 and analogues was observed.
⇄purity => string (3) "N/A"
$value[6]['_source']['purity']
⇄form => string (3) "N/A"
$value[6]['_source']['form']
⇄concentration => string (3) "N/A"
$value[6]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[6]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[6]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄⧉ncbi_pathways => string (362) "Complement And Coagulation Cascades Pathway||198880!!Complement And Coagulat...
$value[6]['_source']['ncbi_pathways']
Complement And Coagulation Cascades Pathway||198880!!Complement And Coagulation Cascades Pathway||83073!!Complement And Coagulation Cascades Pathway||484!!Complement Cascade Pathway||1269241!!Immune System Pathway||1269170!!Innate Immune System Pathway||1269203!!Measles Pathway||213306!!Measles Pathway||213277!!Regulation Of Complement Cascade Pathway||1269250
⇄⧉search_terms => string (654) "aaa17484 human this assay has high sensitivity and excellent specificity for...
$value[6]['_source']['search_terms']
aaa17484 human this assay has high sensitivity and excellent specificity for detection of mbp no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17484_sc elisa kit membrane cofactor protein mcp cd46 ahus2 mic10 molecule complement regulatory tlxcomplement trophoblast leucocyte common antigen lymphocyte reactive tlx tra2.10 36,826 da leukocyte cd_antigen mcp_human 262938 aab24802.1 p15529 q15429 q53gv9 q5hy94 q5vws6 q5vws7 q5vws8 q5vws9 q5vwt0 a0t1t0 a0t1t1 a0t1t2 120920 samples serum plasma tissue homogenates other biological fluids type sandwich range 0.156 10ng ml
⇄⧉products_description => string (825) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[7]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Human EGF monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (400) "aaa12840 human typical testing data standard curve for reference only aaa128...
$value[7]['_source']['search_terms']
aaa12840 human typical testing data standard curve for reference only aaa12840_sc elisa kit epidermal growth factor egf partial urg homg4 pro beta urogastrone 129,746 da egf_human 46242544 aas83395.1 p01133 q52lz6 b4drk7 e7evd2 e9pbf0 gene 611718 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 1000 pg ml 15.6 sensitivity up to 5 intra precision to5
⇄⧉products_description => string (827) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[8]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Porcine EGF monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (402) "aaa13060 porcine typical testing data standard curve for reference only aaa1...
$value[8]['_source']['search_terms']
aaa13060 porcine typical testing data standard curve for reference only aaa13060_sc elisa kit epidermal growth factor egf partial urg homg4 pro beta urogastrone 129,746 da egf_human 46242544 aas83395.1 p01133 q52lz6 b4drk7 e7evd2 e9pbf0 gene 611718 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 1000 pg ml 15.6 sensitivity up to 5 intra precision to5
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||10-2000ng/L!!Sensitivity||5.52ng/L
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[9]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄⧉products_description => string (883) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value[9]['_source']['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Horse EGF antibody. EGF present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Horse EGF Antibody is added and binds to EGF in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated EGF antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Horse EGF. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Horse Epidermal growth factor (also known as EGF) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄products_references => string (3) "N/A"
$value[9]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[9]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[9]['_source']['products_categories']
⇄ncbi_full_name => string (3) "egf"
$value[9]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[9]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[9]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[9]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[9]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[9]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[9]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value[9]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[9]['_source']['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value[9]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[9]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[9]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[9]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[9]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[9]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[9]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[9]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[9]['_source']['products_viewed']
⇄⧉search_terms => string (486) "aaa18995 horse typical testing data standard curve for reference only aaa189...
$value[9]['_source']['search_terms']
aaa18995 horse typical testing data standard curve for reference only aaa18995_sc elisa kit epidermal growth factor egf 1407720218 aww14485.1 samples serum plasma cell culture supernates ascites tissue homogenates or other biological fluids assay type quantitative sandwich detection range 10 2000ng l sensitivity 5.52ng intra precision within an three of known concentration were tested on one plate to assess cv<8 inter between assays in separate cv = sd mean x 100 cv<10 range10 x100
⇄⧉products_description => string (1104) "Intended Uses: This immunoassay kit allows for the in vitro quantitative det...
$value[10]['_source']['products_description']
Intended Uses: This immunoassay kit allows for the in vitro quantitative determination of target antigen concentrations in serum, plasma, tissue homogenates, cell culture supernates or other biological fluids.<br><br>Principle of the Assay: The microtiter plate provided in this kit has been pre-coated with an antibody specific to target antigen. Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody preparation specific for target antigen and then avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. Then a TMB substrate solution is added to each well. Only those wells that contain target antigen, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm +/- 2 nm. The concentration of target antigen in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄products_references => string (3) "N/A"
$value[10]['_source']['products_references']
⇄⧉products_related_diseases => string (221) "Immune System Diseases||328!!Cardiovascular Diseases||162!!Inflammation||134...
Hemostasis Pathway||1332692!!Lysosome Pathway||98762!!Lysosome Pathway||96865!!Platelet Activation, Signaling And Aggregation Pathway||1332702!!Platelet Degranulation Pathway||1332713!!Proteoglycans In Cancer Pathway||782013!!Proteoglycans In Cancer Pathway||782054!!Response To Elevated Platelet Cytosolic Ca2+ Pathway||1332711
⇄⧉search_terms => string (390) "aaa23320 bovine recombinant and natural cd63 antigen typical testing data st...
$value[10]['_source']['search_terms']
aaa23320 bovine recombinant and natural cd63 antigen typical testing data standard curve for reference only aaa23320_sc elisa kit 25,752 da cd_antigen cd63_bovin 45439308 np_991372.1 q9xsk2 nm_205803.1 q3szy2 samples serum plasma tissue homogenates cell culture supernates or other biological fluids detection range 15.6 1000 pg ml sensitivity < 6.67 intra assay precision <=4.9 inter <=9.7
⇄⧉products_description => string (1104) "Intended Uses: This immunoassay kit allows for the in vitro quantitative det...
$value[11]['_source']['products_description']
Intended Uses: This immunoassay kit allows for the in vitro quantitative determination of target antigen concentrations in serum, plasma, tissue homogenates, cell culture supernates or other biological fluids.<br><br>Principle of the Assay: The microtiter plate provided in this kit has been pre-coated with an antibody specific to target antigen. Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody preparation specific for target antigen and then avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. Then a TMB substrate solution is added to each well. Only those wells that contain target antigen, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm +/- 2 nm. The concentration of target antigen in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄products_references => string (3) "N/A"
$value[11]['_source']['products_references']
⇄⧉products_related_diseases => string (205) "Kidney Diseases||198!!Nervous System Diseases||175!!Inflammation||88!!Protei...
⇄⧉products_description => string (674) "Principle of the Assay: This experiment use double-sandwich elisa technique ...
$value[12]['_source']['products_description']
Principle of the Assay: This experiment use double-sandwich elisa technique and the ELISA Kit provided is typical. The pre-coated antibody is Mouse MAC monoclonal antibody and the detecting antibody is polyclonal antibody with biotin labeled. Samples and biotin labeling antibody are added into ELISA plate wells and washed out with PBS or TBS. Then Avidin-peroxidase conjugates are added to ELISA wells in order; Use TMB substrate for coloring after reactant thoroughly washed out by PBS or TBS. TMB turns into blue in peroxidase catalytic and finally turns into yellow under the action of acid. The color depth and the testing factors in samples are positively correlated.
⇄⧉search_terms => string (365) "aaa12476 mouse no cross reaction with other factors typical testing data sta...
$value[12]['_source']['search_terms']
aaa12476 mouse no cross reaction with other factors typical testing data standard curve for reference only aaa12476_sc elisa kit membrane attack complex mac 675237085 cdz11901.1 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 20 ng ml 0.312 sensitivity up to 0.06ng intra precision <= 8 inter 12 range20 <=8 inter12
⇄reactivity => string (45) "Human, Mouse, Rat.<br>Does not react with Pig"
$value[13]['_source']['reactivity']
⇄⧉specificity => string (715) "This MAb is an excellent marker for all nuclei in cells in tissues. It is a ...
$value[13]['_source']['specificity']
This MAb is an excellent marker for all nuclei in cells in tissues. It is a part of a new panel of reagents, which recognizes subcellular organelles or compartments of cells. These markers may be useful in identification of these organelles in cells, tissues, and biochemical preparations. This MAb recognizes an antigen associated with the nuclei in all cells. It can be used to stain the nuclei in cell or tissue preparations and can be used as a nuclear marker in subcellular fractions. It produces a speckled pattern in normal and malignant cells and may be used to stain the nuclei of cells in fixed or frozen tissue sections. It can also be used with paraformaldehyde fixed frozen tissue or cell preparations.
⇄purity => string (3) "N/A"
$value[13]['_source']['purity']
⇄⧉form => string (166) "200ug/ml of Ab purified from Bioreactor Concentrate by Protein A/G. Prepared...
$value[13]['_source']['form']
200ug/ml of Ab purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.
⇄concentration => string (3) "N/A"
$value[13]['_source']['concentration']
⇄storage_stability => string (58) "Store at 2 to 8 degree C. Non-hazardous. No MSDS required."
Flow Cytometry (1-2ug/million cells in 0.1ml)<br>Immunofluorescence (1-2ug/ml)<br>Immunohistochemistry (Formalin-paraffin) (1-2ug/ml for 30 minutes at RT) (Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10mM Citrate Buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes)
⇄⧉testing_protocols => string (1011) "IF (Immunofluorescence)||Immunofluorescentstaining of PFA-fixedHeLa cells wi...
$value[13]['_source']['testing_protocols']
IF (Immunofluorescence)||Immunofluorescentstaining of PFA-fixedHeLa cells with Pan-Nuclear Antigen Monoclonal Antibody (AAA13844) followed by goat anti-mouse IgG-CF488 (green). Membranes labeled with phalloidin (red).||AAA13844_IF6.jpg!!SDS-PAGE||SDS-PAGE Analysis Purified Pan-Nuclear Antigen Monoclonal Antibody (AAA13844). Confirmation of Purity and Integrity of Antibody.||AAA13844_SDS_PAGE5.jpg!!IHC (Immunohistochemistry)||Formalin-fixed, paraffin-embedded Rat Lung stained with Pan-Nuclear Ag Monoclonal Antibody (AAA13844).||AAA13844_IHC4.jpg!!IHC (Immunohistochemistry)||Formalin-fixed, paraffin-embedded Rat Colon stained with Pan-Nuclear Ag Monoclonal Antibody (AAA13844).||AAA13844_IHC3.jpg!!IHC (Immunohistochemistry)||Formalin-fixed, paraffin-embedded human Tonsil stained with Pan-Nuclear Ag Monoclonal Antibody (AAA13844).||AAA13844_IHC2.jpg!!IHC (Immunohistochemistry)||Formalin-fixed, paraffin-embedded human Tonsil stained with Pan-Nuclear Ag Monoclonal Antibody (AAA13844).||AAA13844_IHC.jpg
⇄etc_term1 => string (62) "Cellular Localization||Nuclei!!Immunogen||Nuclei of HL60 cells"
$value[13]['_source']['etc_term1']
⇄etc_term2 => string (41) "Positive Control||All human cells. Tonsil"
⇄⧉products_references => string (666) "Epstein, A.L. and Clevenger, C.V., Identification of nuclear antigens in hum...
$value[13]['_source']['products_references']
Epstein, A.L. and Clevenger, C.V., Identification of nuclear antigens in human cells by immunofluorescence, immunoelectron microscopy, and immuno-biochemical methods using monoclonal antibodies. In Progress on nonhistone protein research, Vol. 1, Isaac Bekhor, ed., 1985, CRC Press, Boca Raton, FL, pp 117-137.Parthenogenetic dopamine neurons from primate embryonic stem cells restore function in experimental Parkinson's diseaseParthenogenetic dopamine neurons from primate embryonic stem cells restore function in experimental Parkinson's diseaseParthenogenetic dopamine neurons from primate embryonic stem cells restore function in experimental Parkinson's diseas
⇄⧉search_terms => string (1063) "aaa13844 mouse human rat does not react with pig monoclonal igg1 kappa nm106...
$value[13]['_source']['search_terms']
aaa13844 mouse human rat does not react with pig monoclonal igg1 kappa nm106 200ug ml of ab purified from bioreactor concentrate by protein a g prepared in 10mm pbs 0.05 bsa azide also available without at 1.0mg this mab is an excellent marker for all nuclei cells tissues it part new panel reagents which recognizes subcellular organelles or compartments these markers may be useful identification and biochemical preparations antigen associated the can used to stain cell tissue as nuclear fractions produces speckled pattern normal malignant fixed frozen sections paraformaldehyde flow cytometry fc facs immunofluorescence if immunocytochemistry icc immunohistochemistry ihc formalin paraffin 0.5 1ug million 0.1ml acetone 0.25 0.5ug 30 minutes rt staining enhanced boiling citrate buffer ph 6.0 10 20 min followed cooling embedded tonsil stained pan ag antibody aaa13844_ihc aaa13844_ihc2 colon aaa13844_ihc3 lung aaa13844_ihc4 partial 27,388 da a6n0i9_orysi 149391483 abr25759.1 cellular localization immunogen hl60 positive control paraffin0.5 0.5ug30 ph6.0
⇄⧉products_description => string (824) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[14]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Rat EGFR monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (696) "aaa13159 rat no cross reaction with other factors typical testing data stand...
$value[14]['_source']['search_terms']
aaa13159 rat no cross reaction with other factors typical testing data standard curve for reference only aaa13159_sc elisa kit epidermal growth factor receptor egfr erbb her1 mena erbb1 pig61 proto oncogene c 1 cell inhibiting protein 40 proliferation inducing 61 tyrosine kinase avian erythroblastic leukemia viral v erb b homolog 69,228 da egfr_human 326467049 adz75461.1 p00533 o00688 o00732 p06268 q14225 q68gs5 q92795 q9bzs2 q9gzx1 q9h2c9 q9h3c9 q9umd7 gene 211980 samples serum plasma or culture supernatant and organizations in the natural recombinant e cad concentration assay type sandwich detection range 10 ng ml 0.156ng sensitivity 0.05 intra precision c1 protein40 inducing61 range10
Buffer||0.1M PBS, pH 7.4 containing 2% Methyl-mannoside!!Preservative||0.2% Sodium azide!!Warnings||This product contains sodium azide, which has been classified as Xn (Harmful), in European Directive 67/548/EEC in the concentration range of 0.1-1.0%. When disposing of this reagent through lead or copper plumbing, flush with copious volumes of water to prevent azide build-up in drains. A blood sample from the tissue donor tested negative for HIV 1, HIV 2, HCV antibodies and HBsAg. No test guarantees a product to be non-infectious. Therefore, all material derived from human fluids or tissues should be considered as potentially infectious.
aaa13426 human metastatic liver immunoaffinity purification sds page denaturing multiple protein bands 150 210kda affinity purified liquid carcinoembryonic antigen cea grade eia elisa suitable as an immunogen for antisera production tracer iodination and stadard immunoassay native related cell adhesion molecule 6 non specific cross reacting ceacam6 nca ceal cd66c 15,545 da q13985_human 553222 aaa51971.1 p40199 q13985 q14921 q14922 q53xp7 reagents cancer research inactivation not applicable buffer 0.1m pbs ph 7.4 containing 2 methyl mannoside preservative 0.2 sodium azide warnings this product contains which has been classified xn harmful in european directive 67 548 eec the concentration range of 0.1 1.0 when disposing reagent through lead or copper plumbing flush with copious volumes water to prevent build up drains a blood sample from tissue donor tested negative hiv 1 hcv antibodies hbsag no test guarantees be infectious therefore all material derived fluids tissues should considered potentially bands150 molecule6 ph7.4 containing2 preservative0.2 directive67 of0.1 hiv1
⇄⧉specificity => string (169) "This assay has high sensitivity and excellent specificity for detection of A...
$value[16]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of Aoc3. No significant cross-reactivity or interference between Aoc3 and analogues was observed.
⇄purity => string (3) "N/A"
$value[16]['_source']['purity']
⇄form => string (3) "N/A"
$value[16]['_source']['form']
⇄concentration => string (3) "N/A"
$value[16]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[16]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[16]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄⧉search_terms => string (651) "aaa17671 mouse this assay has high sensitivity and excellent specificity for...
$value[16]['_source']['search_terms']
aaa17671 mouse this assay has high sensitivity and excellent specificity for detection of aoc3 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17671_sc elisa kit membrane primary amine oxidase vap 1 hpao ssao copper hpaossao semicarbazide sensitive vap1 vascular adhesion protein isoform 2 containing 3 24,533 da aoc3_human 480306390 np_001264660.1 q16853 nm_001277731.1 q45f94 b2rci5 k7esb3 l0l8n9 603735 samples serum plasma tissue homogenates other biological fluids type quantitative sandwich range 31.25 2000pg ml 18.75pg intra precision cv isoform2 containing3
⇄⧉form => string (139) "Supplied as lyophilized form in 20mM Tris, 500mM NaCI, pH8.0, containing 1mM...
$value[17]['_source']['form']
Supplied as lyophilized form in 20mM Tris, 500mM NaCI, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% sarcosyl, 5% trehalose, and preservative.
⇄concentration => string (3) "N/A"
$value[17]['_source']['concentration']
⇄⧉storage_stability => string (599) "Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliq...
$value[17]['_source']['storage_stability']
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.<br>Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.
⇄app_tested => string (66) "SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)"
⇄⧉ncbi_pathways => string (358) "Complement And Coagulation Cascades Pathway||198461!!Complement And Coagulat...
$value[17]['_source']['ncbi_pathways']
Complement And Coagulation Cascades Pathway||198461!!Complement And Coagulation Cascades Pathway||83465!!Complement And Coagulation Cascades Pathway||484!!Complement Cascade Pathway||936714!!Immune System Pathway||936650!!Innate Immune System Pathway||936679!!Measles Pathway||213300!!Measles Pathway||213277!!Regulation Of Complement Cascade Pathway||936721
⇄⧉search_terms => string (787) "aaa20256 e coli > 90 supplied as lyophilized form in 20mm tris 500mm naci ph...
$value[17]['_source']['search_terms']
aaa20256 e coli > 90 supplied as lyophilized form in 20mm tris 500mm naci ph8.0 containing 1mm edta dtt 0.01 sarcosyl 5 trehalose and preservative sds page western blot wb elisa eia immunoprecipitation ip sequence information aaa20256_seq aaa20256_sds3 testing data aaa20256_td2 recombinant protein membrane cofactor mcp cd46 molecule complement regulatory antigen 54.4kda mcp_rat 9506883 np_062063.1 q9z0m4 nm_019190.1 organism rattus norvegicus rat expression system prokaryotic residues met136~val341 accession # with two n terminal tags his tag gst subcellular location cytoplasmic vesicle secretory acrosome inner single pass endotoxin level <1.0eu per 1ug determined by the lal method predicted isoelectric point 6.7 reconstitution reconstitute sterile ddh2o >90 sarcosyl5 point6.7
⇄products_name_syn => string (37) "Outer membrane protein 1B; Porin OmpC"
$value[18]['_source']['products_name_syn']
⇄products_gene_name => string (4) "ompC"
$value[18]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[18]['_source']['products_gene_name_syn']
⇄⧉products_description => string (86) "Forms pores that allow passive diffusion of small molecules across the outer...
$value[18]['_source']['products_description']
Forms pores that allow passive diffusion of small molecules across the outer membrane.
⇄⧉products_references => string (2770) "A comparative study on the genes for three porins of the Escherichia coli ou...
$value[18]['_source']['products_references']
A comparative study on the genes for three porins of the Escherichia coli outer membrane. DNA sequence of the osmoregulated ompC gene.Mizuno T., Chou M.-Y., Inouye M.J. Biol. Chem. 258:6932-6940(1983)
A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map.Itoh T., Aiba H., Baba T., Fujita K., Hayashi K., Inada T., Isono K., Kasai H., Kimura S., Kitakawa M., Kitagawa M., Makino K., Miki T., Mizobuchi K., Mori H., Mori T., Motomura K., Nakade S., Nakamura Y., Nashimoto H., Nishio Y., Oshima T., Saito N., Sampei G., Seki Y., Sivasundaram S., Tagami H., Takeda J., Takemoto K., Wada C., Yamamoto Y., Horiuchi T.DNA Res. 3:379-392(1996)
The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997)
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006)
Automated multiplex sequencing of the E Coli genome.Richterich P., Lakey N., Gryan G., Jaehn L., Mintz L., Robison K., Church G.M. DNA sequence of the promoter region of the ompC gene and the amino acid sequence of the signal peptide of pro-OmpC protein of Escherichia coli.Mizuno T., Chou M.-Y., Inouye M.FEBS Lett. 151:159-164(1983)
Construction of a series of ompF-ompC chimeric genes by in vivo homologous recombination in Escherichia coli and characterization of the translational products.Nogami T., Mizuno T., Mizushima S.J. Bacteriol. 164:797-801(1985)
Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12.Link A.J., Robison K., Church G.M.Electrophoresis 18:1259-1313(1997)
Extraction of membrane proteins by differential solubilization for separation using two-dimensional gel electrophoresis.Molloy M.P., Herbert B.R., Walsh B.J., Tyler M.I., Traini M., Sanchez J.-C., Hochstrasser D.F., Williams K.L., Gooley A.A.Electrophoresis 19:837-844(1998)
Escherichia coli proteome analysis using the gene-protein database.VanBogelen R.A., Abshire K.Z., Moldover B., Olson E.R., Neidhardt F.C.Electrophoresis 18:1243-1251(1997)
Crystal structure of osmoporin OmpC from E. coli at 2.0 A.Basle A., Rummel G., Storici P., Rosenbusch J.P., Schirmer T.J. Mol. Biol. 362:933-942(2006)
Crystal structure of the membrane protein Ompc complex with antibacterial lactoferrin.Baalaji S., Acharya R.K., Singh T.P., Krishnaswamy S.Submitted (SEP-2006)
to the PDB data bank
⇄ncbi_protein_info => string (30) "outer membrane porin protein C"
$value[18]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[18]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (6) "946716"
$value[18]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (8) "54.3 kDa"
$value[18]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (151) "Two-component System Pathway||1114!!Two-component System Pathway||437!!Beta-...
$value[18]['_source']['ncbi_pathways']
Two-component System Pathway||1114!!Two-component System Pathway||437!!Beta-Lactam Resistance Pathway||1060015!!Beta-Lactam Resistance Pathway||1084230
⇄sp_protein_name => string (24) "Outer membrane protein C"
$value[18]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (37) "Outer membrane protein 1B; Porin OmpC"
⇄⧉search_terms => string (1242) "aaa18709 e coli or yeast baculovirus mammalian cell greater equal to 85 puri...
$value[18]['_source']['search_terms']
aaa18709 e coli or yeast baculovirus mammalian cell greater equal to 85 purity as determined by sds page lyophilized liquid format be during the manufacturing process aaa18709_sds aevynkdgnkldlygkvdglhyfsdnkdvdgdqtymrlgfkgetqvtdqltgygqweyqiqgnsaenennswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtygsdnfmqqrgngfatyrntdffglvdglnfavqyqgkngnpsgegftsgvtnngrdalrqngdgvggsitydyegfgiggaissskrtdaqntaayigngdraetytgglkydanniylaaqytqtynatrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdvgatyyfnknmstyvdykinllddnqftrdagintdnivalglvyqf
recombinant protein outer membrane c escherichia strain k12 1b porin ompc butr eck2207 jw2203 meoa par 54.3 kda ompc_ecoli 16130152 np_416719.1 nc_000913.3 p06996 production note special offer host expressed is manufactured from a stock plasmid containing gene colihost stocked in different unit sizes ranging small 10 ug large 1 mg bulk inventory also available has been ordered over and again researchers stood test of time both robust important target for research community it part our new program make most popular targets corresponding hosts expanded with quick processing select fastest delivery among all please contact technical support team email [email protected] more details to85 small10 large1
⇄⧉products_description => string (825) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[19]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Human MAC monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (411) "aaa13055 human no cross reaction with other factors typical testing data sta...
$value[19]['_source']['search_terms']
aaa13055 human no cross reaction with other factors typical testing data standard curve for reference only aaa13055_sc elisa kit membrane attack complex mac 675237085 cdz11901.1 samples serum plasma or cell culture supernatant and organizations in the natural recombinant ltb4 concentration assay type sandwich detection range 1000 pg ml 15.6 sensitivity 5 intra precision <= 8 inter 12 sensitivity5 <=8 inter12
