Western Blot (WB)
(Host: RabbitTarget Name: PURBSample Tissue: Mouse Stomach lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse PURB Polyclonal Antibody | anti-PURB antibody
PURB Antibody-C-terminal region
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PURB; Polyclonal Antibody; PURB Antibody-C-terminal region; transcriptional activator protein Pur-beta; Cager-2; AA114818; D11Bwg0414e; 2310015K15Rik; anti-PURB antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
TVPFKAWGKFGGAFCRYADEMKEIQERQRDKLYERRGGGSGGGDESEGEE
Applicable Applications for anti-PURB antibody
Western Blot (WB)
Protein Size
324 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse PURB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PURBSample Tissue: Mouse Stomach lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PURBSample Tissue: Mouse Stomach lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PURB antibody
Description of Target: Has capacity to bind repeated elements in single-stranded DNA such as the purine-rich single strand of the PUR element located upstream of the MYC gene. Participates in transcriptional and translational regulation of alpha-MHC expression in cardiac myocytes by binding to the purine-rich negative regulatory (PNR) element. Modulates constitutive liver galectin-3 gene transcription by binding to its promoter. May play a role in the dendritic transport of a subset of mRNAs (By similarity). Plays a role in the control of vascular smooth muscle (VSM) alpha-actin gene transcription as repressor in myoblasts and fibroblasts.
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
35kDa
UniProt Protein Name
Transcriptional activator protein Pur-beta
Protein Family
UniProt Gene Name
Purb
UniProt Entry Name
PURB_MOUSE
Similar Products
Product Notes
The PURB purb (Catalog #AAA3249841) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PURB Antibody-C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PURB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PURB purb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TVPFKAWGKF GGAFCRYADE MKEIQERQRD KLYERRGGGS GGGDESEGEE. It is sometimes possible for the material contained within the vial of "PURB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
