Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PTPROSample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PTPRO Polyclonal Antibody | anti-PTPRO antibody

PTPRO Antibody - middle region

Gene Names
PTPRO; NPHS6; PTPU2; GLEPP1; PTP-OC; PTP-U2; PTPROT; R-PTP-O
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PTPRO; Polyclonal Antibody; PTPRO Antibody - middle region; anti-PTPRO antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YPPQNISVRIVNLNKNNWEEQSGNFPEESFMRSQDTIGKEKLFHFTEETP
Sequence Length
597
Applicable Applications for anti-PTPRO antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PTPRO
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PTPROSample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PTPROSample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PTPRO antibody
This gene encodes a member of the R3 subtype family of receptor-type protein tyrosine phosphatases. These proteins are localized to the apical surface of polarized cells and may have tissue-specific functions through activation of Src family kinases. This gene contains two distinct promoters, and alternatively spliced transcript variants encoding multiple isoforms have been observed. The encoded proteins may have multiple isoform-specific and tissue-specific functions, including the regulation of osteoclast production and activity, inhibition of cell proliferation and facilitation of apoptosis. This gene is a candidate tumor suppressor, and decreased expression of this gene has been observed in several types of cancer.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65 kDa
NCBI Official Full Name
receptor-type tyrosine-protein phosphatase O isoform b
NCBI Official Synonym Full Names
protein tyrosine phosphatase receptor type O
NCBI Official Symbol
PTPRO
NCBI Official Synonym Symbols
NPHS6; PTPU2; GLEPP1; PTP-OC; PTP-U2; PTPROT; R-PTP-O
NCBI Protein Information
receptor-type tyrosine-protein phosphatase O
UniProt Protein Name
Receptor-type tyrosine-protein phosphatase O
UniProt Gene Name
PTPRO
UniProt Synonym Gene Names
GLEPP1; PTPU2; R-PTP-O; PTP-U2; PTPase U2
UniProt Entry Name
PTPRO_HUMAN

NCBI Description

This gene encodes a member of the R3 subtype family of receptor-type protein tyrosine phosphatases. These proteins are localized to the apical surface of polarized cells and may have tissue-specific functions through activation of Src family kinases. This gene contains two distinct promoters, and alternatively spliced transcript variants encoding multiple isoforms have been observed. The encoded proteins may have multiple isoform-specific and tissue-specific functions, including the regulation of osteoclast production and activity, inhibition of cell proliferation and facilitation of apoptosis. This gene is a candidate tumor suppressor, and decreased expression of this gene has been observed in several types of cancer. [provided by RefSeq, May 2011]

Uniprot Description

PTPRO: Possesses tyrosine phosphatase activity. Plays a role in regulating the glomerular pressure/filtration rate relationship through an effect on podocyte structure and function. Defects in PTPRO are the cause of nephrotic syndrome type 6 (NPHS6). NPHS6 is a renal disease characterized clinically by proteinuria, hypoalbuminemia, hyperlipidemia and edema. Kidney biopsies show non-specific histologic changes such as focal segmental glomerulosclerosis and diffuse mesangial proliferation. Some affected individuals have an inherited steroid-resistant form and progress to end-stage renal failure. Belongs to the protein-tyrosine phosphatase family. Receptor class 3 subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor protein phosphatase, tyrosine; EC 3.1.3.48; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 12p13.3-p13.2|12p13-p12

Cellular Component: neuron projection; growth cone; integral to plasma membrane; lamellipodium; axon; apical plasma membrane; integral to membrane; dendritic spine; plasma membrane; lateral plasma membrane

Molecular Function: Wnt-protein binding; protein binding; protein homodimerization activity; phosphoric monoester hydrolase activity; transmembrane receptor protein tyrosine phosphatase activity; protein tyrosine phosphatase activity

Biological Process: lamellipodium biogenesis; monocyte chemotaxis; axon guidance; regulation of glomerular filtration; negative regulation of glomerular filtration; cell morphogenesis; protein amino acid dephosphorylation; glomerulus development

Disease: Nephrotic Syndrome, Type 6

Research Articles on PTPRO

Similar Products

Product Notes

The PTPRO ptpro (Catalog #AAA3221721) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTPRO Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTPRO can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PTPRO ptpro for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YPPQNISVRI VNLNKNNWEE QSGNFPEESF MRSQDTIGKE KLFHFTEETP. It is sometimes possible for the material contained within the vial of "PTPRO, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.