Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human PTPLB Polyclonal Antibody | anti-PTPLB antibody

PTPLB (Protein Tyrosine Phosphatase-like (Proline instead of Catalytic Arginine), Member b) (MaxLight 405)

Gene Names
PTPLB; HACD2
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
PTPLB; Polyclonal Antibody; PTPLB (Protein Tyrosine Phosphatase-like (Proline instead of Catalytic Arginine); Member b) (MaxLight 405); Protein Tyrosine Phosphatase-like (Proline instead of Catalytic Arginine); Member b; anti-PTPLB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PTPLB.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-PTPLB antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PTPLB (NP_940684.1, 1aa-254aa) full-length human protein.
Immunogen Sequence
MAAVAATKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGLVRAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAVTHSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVSGELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQRRKILSHTEEHKKFE
Conjugate
MaxLight405
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PTPLB antibody
Rabbit polyclonal antibody raised against a full-length human PTPLB protein.
Product Categories/Family for anti-PTPLB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,368 Da
NCBI Official Full Name
very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2
NCBI Official Synonym Full Names
protein tyrosine phosphatase-like (proline instead of catalytic arginine), member b
NCBI Official Symbol
PTPLB
NCBI Official Synonym Symbols
HACD2
NCBI Protein Information
very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2; very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2; protein-tyrosine phosphatase-like member B; very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 2
UniProt Protein Name
Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2
UniProt Gene Name
PTPLB
UniProt Synonym Gene Names
HACD2; HACD2
UniProt Entry Name
HACD2_HUMAN

Similar Products

Product Notes

The PTPLB ptplb (Catalog #AAA6451481) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTPLB (Protein Tyrosine Phosphatase-like (Proline instead of Catalytic Arginine), Member b) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTPLB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PTPLB ptplb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PTPLB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.