Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PTP4A1 expression in transfected 293T cell line by PTP4A1 polyclonal antibody. Lane 1: PTP4A1 transfected lysate (19.03kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human PTP4A1 Polyclonal Antibody | anti-PTP4A1 antibody

PTP4A1 (Protein-tyrosine Phosphatase 4a1, Protein Tyrosine Phosphatase Type IVA 1, Protein-tyrosine Phosphatase of Regenerating Liver 1, PRL1, PRL-1, PTPCAAX1, PTP(CAAXI))

Gene Names
PTP4A1; HH72; PRL1; PRL-1; PTPCAAX1; PTP(CAAX1)
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PTP4A1; Polyclonal Antibody; PTP4A1 (Protein-tyrosine Phosphatase 4a1; Protein Tyrosine Phosphatase Type IVA 1; Protein-tyrosine Phosphatase of Regenerating Liver 1; PRL1; PRL-1; PTPCAAX1; PTP(CAAXI)); Anti -PTP4A1 (Protein-tyrosine Phosphatase 4a1; anti-PTP4A1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PTP4A1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
Applicable Applications for anti-PTP4A1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human PTP4A1, aa1-173 (NP_003454.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PTP4A1 expression in transfected 293T cell line by PTP4A1 polyclonal antibody. Lane 1: PTP4A1 transfected lysate (19.03kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PTP4A1 expression in transfected 293T cell line by PTP4A1 polyclonal antibody. Lane 1: PTP4A1 transfected lysate (19.03kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-PTP4A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,815 Da
NCBI Official Full Name
protein tyrosine phosphatase type IVA 1
NCBI Official Synonym Full Names
protein tyrosine phosphatase type IVA, member 1
NCBI Official Symbol
PTP4A1
NCBI Official Synonym Symbols
HH72; PRL1; PRL-1; PTPCAAX1; PTP(CAAX1)
NCBI Protein Information
protein tyrosine phosphatase type IVA 1; protein-tyrosine phosphatase 4a1; protein tyrosine phosphatase type IVA protein 1; protein-tyrosine phosphatase of regenerating liver 1
UniProt Protein Name
Protein tyrosine phosphatase type IVA 1
UniProt Gene Name
PTP4A1
UniProt Synonym Gene Names
PRL1; PTPCAAX1; PRL-1
UniProt Entry Name
TP4A1_HUMAN

NCBI Description

This gene encodes a member of a small class of prenylated protein tyrosine phosphatases (PTPs), which contain a PTP domain and a characteristic C-terminal prenylation motif. The encoded protein is a cell signaling molecule that plays regulatory roles in a variety of cellular processes, including cell proliferation and migration. The protein may also be involved in cancer development and metastasis. This tyrosine phosphatase is a nuclear protein, but may associate with plasma membrane by means of its prenylation motif. Pseudogenes related to this gene are located on chromosomes 1, 2, 5, 7, 11 and X. [provided by RefSeq, Jun 2013]

Uniprot Description

Function: Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. May play a role in the development and maintenance of differentiating epithelial tissues. Enhances cell proliferation, cell motility and invasive activity, and promotes cancer metastasis. Ref.10 Ref.12 Ref.13

Catalytic activity: Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. Ref.1

Enzyme regulation: Inhibited by sodium orthovanadate and pentamidine. Ref.11

Subunit structure: Homotrimer. Interacts with ATF5

By similarity. Interacts with tubulin. Ref.10 Ref.16

Subcellular location: Cell membrane. Early endosome. Endoplasmic reticulum. Cytoplasm. Cytoplasm › cytoskeleton › spindle. Note: And mitotic spindle. Ref.9 Ref.10 Ref.16

Tissue specificity: Expressed in bone marrow, lymph nodes, T lymphocytes, spleen, thymus and tonsil. Overexpressed in tumor cell lines. Ref.9 Ref.10

Developmental stage: Expressed in fetal liver. Ref.9

Induction: Strongly down-regulated upon tetrodotoxin treatment. Ref.11 Ref.14

Post-translational modification: Farnesylated. Farnesylation is required for membrane targeting. Unfarnesylated forms are shifted into the nucleus.

Sequence similarities: Belongs to the protein-tyrosine phosphatase family.Contains 1 tyrosine-protein phosphatase domain.

Research Articles on PTP4A1

Similar Products

Product Notes

The PTP4A1 ptp4a1 (Catalog #AAA649202) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PTP4A1 (Protein-tyrosine Phosphatase 4a1, Protein Tyrosine Phosphatase Type IVA 1, Protein-tyrosine Phosphatase of Regenerating Liver 1, PRL1, PRL-1, PTPCAAX1, PTP(CAAXI)) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTP4A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the PTP4A1 ptp4a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MARMNRPAPV EVTYKNMRFL ITHNPTNATL NKFIEELKKY GVTTIVRVCE ATYDTTLVEK EGIHVLDWPF DDGAPPSNQI VDDWLSLVKI KFREEPGCCI AVHCVAGLGR APVLVALALI EGGMKYEDAV QFIRQKRRGA FNSKQLLYLE KYRPKMRLRF KDSNGHRNNC CIQ. It is sometimes possible for the material contained within the vial of "PTP4A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.