Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PTGER3Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Rabbit PTGER3 Polyclonal Antibody | anti-PTGER3 antibody

PTGER3 antibody - C-terminal region

Gene Names
PTGER3; EP3; EP3e; EP3-I; EP3-II; EP3-IV; EP3-VI; PGE2-R; EP3-III
Reactivity
Horse, Human, Rabbit
Applications
Western Blot
Purity
Protein A purified
Synonyms
PTGER3; Polyclonal Antibody; PTGER3 antibody - C-terminal region; anti-PTGER3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLER
Sequence Length
390
Applicable Applications for anti-PTGER3 antibody
Western Blot (WB)
Homology
Horse: 92%; Human: 100%; Rabbit: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PTGER3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PTGER3Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PTGER3Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-PTGER3 Antibody Titration: 2.4ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-PTGER3 Antibody Titration: 2.4ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-PTGER3 antibody
This is a rabbit polyclonal antibody against PTGER3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PTGER3 is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli.
Product Categories/Family for anti-PTGER3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
prostaglandin E2 receptor EP3 subtype isoform 4
NCBI Official Synonym Full Names
prostaglandin E receptor 3
NCBI Official Symbol
PTGER3
NCBI Official Synonym Symbols
EP3; EP3e; EP3-I; EP3-II; EP3-IV; EP3-VI; PGE2-R; EP3-III
NCBI Protein Information
prostaglandin E2 receptor EP3 subtype
UniProt Protein Name
Prostaglandin E2 receptor EP3 subtype
Protein Family
UniProt Gene Name
PTGER3
UniProt Synonym Gene Names
PGE receptor EP3 subtype
UniProt Entry Name
PE2R3_HUMAN

NCBI Description

The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009]

Uniprot Description

PTGER3: Receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G-I proteins, and to an elevation of intracellular calcium. The various isoforms have identical ligand binding properties but can interact with different second messenger systems. Belongs to the G-protein coupled receptor 1 family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1

Chromosomal Location of Human Ortholog: 1p31.2

Cellular Component: integral to plasma membrane; integral to membrane; plasma membrane; nuclear envelope

Molecular Function: ligand-dependent nuclear receptor activity; prostaglandin E receptor activity

Biological Process: G-protein signaling, coupled to cAMP nucleotide second messenger; cell death; G-protein coupled receptor protein signaling pathway; elevation of cytosolic calcium ion concentration; intracellular receptor-mediated signaling pathway; transcription, DNA-dependent; bicarbonate transport; positive regulation of fever; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); response to lipopolysaccharide; fever

Research Articles on PTGER3

Similar Products

Product Notes

The PTGER3 ptger3 (Catalog #AAA3201863) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTGER3 antibody - C-terminal region reacts with Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's PTGER3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PTGER3 ptger3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LDPWVYLLLR KILLRKFCQI RYHTNNYASS STSLPCQCSS TLMWSDHLER. It is sometimes possible for the material contained within the vial of "PTGER3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.