Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PTGDR AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)

Rabbit anti-Human PTGDR Polyclonal Antibody | anti-PTGDR antibody

PTGDR antibody - C-terminal region

Gene Names
PTGDR; DP; AS1; DP1; ASRT1; PTGDR1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PTGDR; Polyclonal Antibody; PTGDR antibody - C-terminal region; anti-PTGDR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SCTRDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYY
Sequence Length
359
Applicable Applications for anti-PTGDR antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PTGDR AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)

Western Blot (WB) (WB Suggested Anti-PTGDR AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
Related Product Information for anti-PTGDR antibody
This is a rabbit polyclonal antibody against PTGDR. It was validated on Western Blot

Target Description: PTGDR is a receptor for prostaglandin D2 (PGD2). The activity of this receptor is mainly mediated by G(s) proteins that stimulate adenylate cyclase, resulting in an elevation of intracellular cAMP. A mobilization of calcium is also observed, but without formation of inositol 1,4,5-trisphosphate.
Product Categories/Family for anti-PTGDR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
prostaglandin D2 receptor isoform 1
NCBI Official Synonym Full Names
prostaglandin D2 receptor
NCBI Official Symbol
PTGDR
NCBI Official Synonym Symbols
DP; AS1; DP1; ASRT1; PTGDR1
NCBI Protein Information
prostaglandin D2 receptor
UniProt Protein Name
Prostaglandin D2 receptor
Protein Family
UniProt Gene Name
PTGDR
UniProt Synonym Gene Names
PGD receptor
UniProt Entry Name
PD2R_HUMAN

NCBI Description

This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor (GPCR) superfamily. The receptors are seven-pass transmembrane proteins that respond to extracellular cues and activate intracellular signal transduction pathways. This protein is reported to be a receptor for prostaglandin D2, which is a mediator of allergic inflammation and allergic airway inflammation in asthma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

PTGDR: Receptor for prostaglandin D2 (PGD2). The activity of this receptor is mainly mediated by G(s) proteins that stimulate adenylate cyclase, resulting in an elevation of intracellular cAMP. A mobilization of calcium is also observed, but without formation of inositol 1,4,5-trisphosphate. Genetic variations in PTGDR are associated with susceptibility to asthma-related traits type 1 (ASRT1). Asthma-related traits include clinical symptoms of asthma, such as coughing, wheezing and dyspnea. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1; Receptor, GPCR

Chromosomal Location of Human Ortholog: 14q22.1

Cellular Component: integral to membrane; plasma membrane

Molecular Function: protein binding; prostaglandin J receptor activity; prostaglandin D receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; male sex determination; adenosine metabolic process; sleep; inflammatory response

Disease: Asthma-related Traits, Susceptibility To, 1

Research Articles on PTGDR

Similar Products

Product Notes

The PTGDR ptgdr (Catalog #AAA3215171) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTGDR antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTGDR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PTGDR ptgdr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SCTRDCAEPR ADGREASPQP LEELDHLLLL ALMTVLFTMC SLPVIYRAYY. It is sometimes possible for the material contained within the vial of "PTGDR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.