Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PTCRASample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human PTCRA Polyclonal Antibody | anti-PTCRA antibody

PTCRA Antibody - C-terminal region

Gene Names
PTCRA; PTA; PT-ALPHA
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PTCRA; Polyclonal Antibody; PTCRA Antibody - C-terminal region; anti-PTCRA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TSSPRPQPRDRRWGDTPPGRKPGSPVWGEGSYLSSYPTCPAQAWCSRSAL
Sequence Length
174
Applicable Applications for anti-PTCRA antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PTCRA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PTCRASample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PTCRASample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PTCRA antibody
This is a rabbit polyclonal antibody against PTCRA. It was validated on Western Blot

Target Description: The protein encoded by this gene is a single-pass type I membrane protein that is found in immmature but not mature T-cells. Along with TCRB and CD3 complex, the encoded protein forms the pre-T-cell receptor complex, which regulates early T-cell development. Four transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-PTCRA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
pre T-cell antigen receptor alpha isoform 1
NCBI Official Synonym Full Names
pre T cell antigen receptor alpha
NCBI Official Symbol
PTCRA
NCBI Official Synonym Symbols
PTA; PT-ALPHA
NCBI Protein Information
pre T-cell antigen receptor alpha
UniProt Protein Name
Pre T-cell antigen receptor alpha
UniProt Gene Name
PTCRA
UniProt Synonym Gene Names
pT-alpha; pTa

NCBI Description

The protein encoded by this gene is a single-pass type I membrane protein that is found in immmature but not mature T-cells. Along with TCRB and CD3 complex, the encoded protein forms the pre-T-cell receptor complex, which regulates early T-cell development. Four transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2011]

Uniprot Description

PTCRA: The pre-T-cell receptor complex (composed of PTCRA, TCRB and the CD3 complex) regulates early T-cell development. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: integral component of membrane

Molecular Function: protein binding

Research Articles on PTCRA

Similar Products

Product Notes

The PTCRA ptcra (Catalog #AAA3219555) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTCRA Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTCRA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PTCRA ptcra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TSSPRPQPRD RRWGDTPPGR KPGSPVWGEG SYLSSYPTCP AQAWCSRSAL. It is sometimes possible for the material contained within the vial of "PTCRA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.