Western Blot (WB)
(Host: RabbitTarget Name: PTCD3Sample Type: RPMI-8226 Whole Cell lysatesAntibody Dilution: 1.0ug/mlPTCD3 is supported by BioGPS gene expression data to be expressed in RPMI 8226)
Rabbit PTCD3 Polyclonal Antibody | anti-PTCD3 antibody
PTCD3 Antibody - C-terminal region
Gene Names
PTCD3; MRP-S39
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PTCD3; Polyclonal Antibody; PTCD3 Antibody - C-terminal region; anti-PTCD3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LEVIPKIWKDSKEYGHTFRSDLREEILMLMARDKHPPELQVAFADCAADI
Sequence Length
280
Applicable Applications for anti-PTCD3 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PTCD3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PTCD3Sample Type: RPMI-8226 Whole Cell lysatesAntibody Dilution: 1.0ug/mlPTCD3 is supported by BioGPS gene expression data to be expressed in RPMI 8226)
Western Blot (WB)
(Host: RabbitTarget Name: PTCD3Sample Type: RPMI-8226 Whole Cell lysatesAntibody Dilution: 1.0ug/mlPTCD3 is supported by BioGPS gene expression data to be expressed in RPMI 8226)
Related Product Information for anti-PTCD3 antibody
This is a rabbit polyclonal antibody against PTCD3. It was validated on Western Blot
Target Description: Mitochondrial RNA-binding protein that has a role in mitochondrial translation.
Target Description: Mitochondrial RNA-binding protein that has a role in mitochondrial translation.
Product Categories/Family for anti-PTCD3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
pentatricopeptide repeat domain-containing protein 3, mitochondrial
NCBI Official Synonym Full Names
pentatricopeptide repeat domain 3
NCBI Official Symbol
PTCD3
NCBI Official Synonym Symbols
MRP-S39
NCBI Protein Information
pentatricopeptide repeat domain-containing protein 3, mitochondrial
UniProt Protein Name
Pentatricopeptide repeat domain-containing protein 3, mitochondrial
Protein Family
UniProt Gene Name
PTCD3
UniProt Synonym Gene Names
MRPS39; MRP-S39; TRG-15
UniProt Entry Name
PTCD3_HUMAN
Research Articles on PTCD3
Similar Products
Product Notes
The PTCD3 ptcd3 (Catalog #AAA3217407) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTCD3 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PTCD3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PTCD3 ptcd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LEVIPKIWKD SKEYGHTFRS DLREEILMLM ARDKHPPELQ VAFADCAADI. It is sometimes possible for the material contained within the vial of "PTCD3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
