Rabbit PSMA3 Polyclonal Antibody | anti-PSMA3 antibody

Anti-PSMA3 Antibody

Cat. Num. AAA178845

• Gene Names: PSMA3; HC8; PSC3
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen affinity purified.
• Synonyms: PSMA3; Polyclonal Antibody; Anti-PSMA3 Antibody; HC8; Macropain subunit C8; PSC8; psmA3; P25788; Proteasome subunit alpha type-3; proteasome subunit alpha 3; anti-PSMA3 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 255

• Applicable Applications for anti-PSMA3 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot: 0.1-0.5ug/ml; Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml
• Notes: Tested Species: In-house tested species with positive results.; By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.; Other applications have not been tested.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PSMA3 (88-127aa LADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYS), identical to the related mouse and rat sequences.
• Preparation and Storage: Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of PSMA3 expression in rat testis extract (lane 1), mouse lung extract (lane 2) and 293T whole cell lysates (lane 3). PSMA3 at 28KD was detected using rabbit anti- PSMA3 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(PSMA3 was detected in paraffin-embedded sections of mouse brain tissues using rabbit anti- PSMA3 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(PSMA3 was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- PSMA3 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(PSMA3 was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- PSMA3 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method. )

Related Product Information for anti-PSMA3 antibody

Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-3(PSMA3) detection.
Background: Proteasome subunit alpha type-3, also known as macropain subunit C8 and proteasome component C8, is a protein that in humans is encoded by the PSMA3 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.

References

1. Coux O, Tanaka K, Goldberg AL (Nov 1996). "Structure and functions of the 20S and 26S proteasomes".Annu Rev Biochem 65: 801-47.
2. Tamura T, Lee DH, Osaka F, Fujiwara T, Shin S, Chung CH, Tanaka K, Ichihara A (Jun 1991). "Molecular cloning and sequence analysis of cDNAs for five major subunits of human proteasomes (multi-catalytic proteinase complexes)". Biochim Biophys Acta 1089 (1): 95-102.

NCBI and Uniprot Product Information

• NCBI GI #: 4506183
• NCBI GeneID: 5684
• NCBI Accession #: NP_002779.1
• NCBI GenBank Nucleotide #: NM_002788.3
• UniProt Accession #: P25788; Q86U83; Q8N1D8; Q9BS70; B2RCK6
• Molecular Weight: 27,647 Da
• NCBI Official Full Name: proteasome subunit alpha type-3 isoform 1
• NCBI Official Synonym Full Names: proteasome subunit alpha 3
• NCBI Official Symbol: PSMA3
• NCBI Official Synonym Symbols: HC8; PSC3
• NCBI Protein Information: proteasome subunit alpha type-3
• UniProt Protein Name: Proteasome subunit alpha type-3
• Protein Family: Phenol-soluble modulin alpha 3 peptide
• UniProt Gene Name: PSMA3
• UniProt Synonym Gene Names: HC8; PSC8

NCBI Description

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

PSMA3: a proteasomal protein of the T1A peptidase family. The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. Two alternatively spliced isoforms have been identified.

Protein type: EC 3.4.25.1; Protease; Proteasome complex

Chromosomal Location of Human Ortholog: 14q23.1

Cellular Component: cytoplasm; cytosol; nucleoplasm; nucleus; proteasome complex; proteasome core complex

Molecular Function: protein binding

Biological Process: anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; MAPKKK cascade; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; proteasomal ubiquitin-dependent protein catabolic process; protein polyubiquitination; regulation of amino acid metabolic process; regulation of endopeptidase activity; regulation of mRNA stability; stimulatory C-type lectin receptor signaling pathway; T cell receptor signaling pathway; tumor necrosis factor-mediated signaling pathway; Wnt receptor signaling pathway, planar cell polarity pathway