Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PSMA2Sample Type: 293TAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that PSMA2 is expressed in HEK293T)

Rabbit PSMA2 Polyclonal Antibody | anti-PSMA2 antibody

PSMA2 antibody - N-terminal region

Gene Names
PSMA2; MU; HC3; PSC2; PMSA2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PSMA2; Polyclonal Antibody; PSMA2 antibody - N-terminal region; anti-PSMA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV
Sequence Length
234
Applicable Applications for anti-PSMA2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PSMA2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PSMA2Sample Type: 293TAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that PSMA2 is expressed in HEK293T)

Western Blot (WB) (Host: RabbitTarget Name: PSMA2Sample Type: 293TAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that PSMA2 is expressed in HEK293T)

Western Blot (WB)

(Host: RabbitTarget Name: PSMA2Sample Type: 721_BAntibody Dilution: 1.0ug/mlPSMA2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (Host: RabbitTarget Name: PSMA2Sample Type: 721_BAntibody Dilution: 1.0ug/mlPSMA2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB)

(Host: RabbitTarget Name: PSMA2Sample Type: HelaAntibody Dilution: 1.0ug/mlPSMA2 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (Host: RabbitTarget Name: PSMA2Sample Type: HelaAntibody Dilution: 1.0ug/mlPSMA2 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB)

(Host: RabbitTarget Name: PSMA2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PSMA2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PSMA2Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PSMA2Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PSMA2Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PSMA2Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PSMA2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PSMA2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PSMA2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PSMA2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PSMA2Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PSMA2Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PSMA2Sample Type: JurkatAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that PSMA2 is expressed in Jurkat)

Western Blot (WB) (Host: RabbitTarget Name: PSMA2Sample Type: JurkatAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that PSMA2 is expressed in Jurkat)

Western Blot (WB)

(Host: RabbitTarget Name: PSMA2Sample Type: MCF7Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that PSMA2 is expressed in MCF7)

Western Blot (WB) (Host: RabbitTarget Name: PSMA2Sample Type: MCF7Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that PSMA2 is expressed in MCF7)

Western Blot (WB)

(WB Suggested Anti-PSMA2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-PSMA2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-PSMA2 antibody
This is a rabbit polyclonal antibody against PSMA2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA2 is a member of the peptidase T1A family, that is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-PSMA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
proteasome subunit alpha type-2
NCBI Official Synonym Full Names
proteasome subunit alpha 2
NCBI Official Symbol
PSMA2
NCBI Official Synonym Symbols
MU; HC3; PSC2; PMSA2
NCBI Protein Information
proteasome subunit alpha type-2
UniProt Protein Name
Proteasome subunit alpha type-2
Protein Family
UniProt Gene Name
PSMA2
UniProt Synonym Gene Names
HC3; PSC3
UniProt Entry Name
PSA2_HUMAN

NCBI Description

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. [provided by RefSeq, Jul 2008]

Uniprot Description

PSMA2: a proteasomal protein of the T1A peptidase family. The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. The component C3 may have a potential regulatory effect on another component(s) of the proteasome complex through tyrosine phosphorylation.

Protein type: EC 3.4.25.1; Proteasome complex; Protease

Chromosomal Location of Human Ortholog: 7p13

Cellular Component: nucleoplasm; proteasome complex; proteasome core complex; cytosol; nucleus

Molecular Function: threonine endopeptidase activity; protein binding

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; protein polyubiquitination; viral reproduction; apoptosis; response to virus; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; regulation of apoptosis; antigen processing and presentation of peptide antigen via MHC class I; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I; gene expression; mitotic cell cycle; regulation of amino acid metabolic process; negative regulation of apoptosis; G1/S transition of mitotic cell cycle

Research Articles on PSMA2

Similar Products

Product Notes

The PSMA2 psma2 (Catalog #AAA3212782) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PSMA2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PSMA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PSMA2 psma2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VGIKAANGVV LATEKKQKSI LYDERSVHKV EPITKHIGLV YSGMGPDYRV. It is sometimes possible for the material contained within the vial of "PSMA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.