Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Human Jurkat)

Rabbit PSIP1 Polyclonal Antibody | anti-PSIP1 antibody

PSIP1 antibody - middle region

Gene Names
PSIP1; p52; p75; PAIP; DFS70; LEDGF; PSIP2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PSIP1; Polyclonal Antibody; PSIP1 antibody - middle region; anti-PSIP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIK
Sequence Length
530
Applicable Applications for anti-PSIP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PSIP1
Conjugation
Unconjugated
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Human Jurkat)

Western Blot (WB) (Human Jurkat)

Western Blot (WB)

(WB Suggested Anti-PSIP1 AntibodyPositive Control: Lane 1: 5ug mouse brain cytoplasm Lane 2: 5ug mouse brain nucleusPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti rabbit - IR-dyeSecondry Antibody Dilution : 1:10,000Submitted by: Anonymous)

Western Blot (WB) (WB Suggested Anti-PSIP1 AntibodyPositive Control: Lane 1: 5ug mouse brain cytoplasm Lane 2: 5ug mouse brain nucleusPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti rabbit - IR-dyeSecondry Antibody Dilution : 1:10,000Submitted by: Anonymous)

Western Blot (WB)

(WB Suggested Anti-PSIP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysatePSIP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (WB Suggested Anti-PSIP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysatePSIP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-PSIP1 antibody
This is a rabbit polyclonal antibody against PSIP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PSIP1 encodes a multidomain adaptor protein that interacts with the nuclear import apparatus, lentiviral IN proteins and chromatin by means of an NLS, an IBD and additional chromatin-interacting domains.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
PC4 and SFRS1-interacting protein isoform 2
NCBI Official Synonym Full Names
PC4 and SFRS1 interacting protein 1
NCBI Official Symbol
PSIP1
NCBI Official Synonym Symbols
p52; p75; PAIP; DFS70; LEDGF; PSIP2
NCBI Protein Information
PC4 and SFRS1-interacting protein
UniProt Protein Name
PC4 and SFRS1-interacting protein
UniProt Gene Name
PSIP1
UniProt Synonym Gene Names
DFS70; LEDGF; PSIP2; DFS 70
UniProt Entry Name
PSIP1_HUMAN

Uniprot Description

LEDGF: Transcriptional coactivator involved in neuroepithelial stem cell differentiation and neurogenesis. Involved in particular in lens epithelial cell gene regulation and stress responses. May play an important role in lens epithelial to fiber cell terminal differentiation. May play a protective role during stress-induced apoptosis. Isoform 2 is a more general and stronger transcriptional coactivator. Isoform 2 may also act as an adapter to coordinate pre-mRNA splicing. Cellular cofactor for lentiviral integration. Monomer. Interacts with IFRD1/PC4. Isoform 2 interacts with SFRS1. Isoform 1 interacts POGZ and CDCA7L. Isoform 1 interacts with lentiviral integrase and acts as a chromatin tethering factor to the chromosomal DNA. Isoform 1 interacts in particular with the human HIV-1 integrase protein (HIV-1 IN), determining its nuclear localization, its tight association with chromatin and its protection from the proteasome. Isoform 1 interacts also with HIV-2 IN. Isoform 2 does not interact with HIV-1 IN. Widely expressed. Expressed at high level in the thymus. Expressed in fetal and adult brain. Expressed in neurons, but not astrocytes. Markedly elevated in fetal as compared to adult brain. In the adult brain, expressed in the subventricular zone (SVZ), in hippocampus, and undetectable elsewhere. In the fetal brain, expressed in the germinal neuroepithelium and cortical plate regions. Belongs to the HDGF family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 9p22.3

Cellular Component: cytosol; nucleoplasm

Molecular Function: protein binding

Biological Process: nuclear mRNA 5'-splice site recognition; nuclear transport; response to heat; response to oxidative stress

Research Articles on PSIP1

Similar Products

Product Notes

The PSIP1 psip1 (Catalog #AAA3202193) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PSIP1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's PSIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PSIP1 psip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AADRKRKQEE QMETEQQNKD EGKKPEVKKV EKKRETSMDS RLQRIHAEIK. It is sometimes possible for the material contained within the vial of "PSIP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.