Western Blot (WB)
(PRSS22 antibody (MBS5300063) used at 1 ug/ml to detect target protein.)
Rabbit PRSS22 Polyclonal Antibody | anti-PRSS22 antibody
PRSS22 antibody
Applications
Western Blot
Purity
Affinity purified
Synonyms
PRSS22; Polyclonal Antibody; PRSS22 antibody; Polyclonal PRSS22; Anti-PRSS22; MGC9599; PRSS-22; BSSP-4; Protease Serine 22; PRSS 22; SP001LA; hBSSP-4; anti-PRSS22 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
PRSS22 antibody was raised against the N terminal of PRSS22
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRSS22 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
334
Applicable Applications for anti-PRSS22 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
This gene encodes a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. The gene is part of a cluster of serine protease genes on chromosome 16.
Cross-Reactivity
Human
Immunogen
PRSS22 antibody was raised using the N terminal of PRSS22 corresponding to a region with amino acids IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(PRSS22 antibody (MBS5300063) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(PRSS22 antibody (MBS5300063) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-PRSS22 antibody
Rabbit polyclonal PRSS22 antibody raised against the N terminal of PRSS22
Product Categories/Family for anti-PRSS22 antibody
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
34 kDa (MW of target protein)
NCBI Official Full Name
PRSS22, partial
UniProt Protein Name
Brain-specific serine protease 4
Protein Family
UniProt Gene Name
PRSS22
UniProt Synonym Gene Names
BSSP4; PRSS26; BSSP-4
UniProt Entry Name
BSSP4_HUMAN
Uniprot Description
PRSS22: Preferentially cleaves the synthetic substrate H-D-Leu- Thr-Arg-pNA compared to tosyl-Gly-Pro-Arg-pNA. Belongs to the peptidase S1 family.
Protein type: Secreted, signal peptide; Protease; Secreted; EC 3.4.21.-
Chromosomal Location of Human Ortholog: 16p13.3
Cellular Component: extracellular region
Molecular Function: serine-type endopeptidase activity
Biological Process: proteolysis
Similar Products
Product Notes
The PRSS22 prss22 (Catalog #AAA5300063) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PRSS22 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the PRSS22 prss22 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRSS22, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
