Western Blot (WB)
(Host: RabbitTarget Name: PRSS21Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)
Rabbit PRSS21 Polyclonal Antibody | anti-PRSS21 antibody
PRSS21 antibody - N-terminal region
Gene Names
PRSS21; ESP1; ESP-1; TEST1; TESTISIN
Reactivity
Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRSS21; Polyclonal Antibody; PRSS21 antibody - N-terminal region; anti-PRSS21 antibody
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCF
Sequence Length
300
Applicable Applications for anti-PRSS21 antibody
Western Blot (WB)
Homology
Guinea Pig: 83%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PRSS21
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PRSS21Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PRSS21Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(WB Suggested Anti-PRSS21 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Western Blot (WB)
(WB Suggested Anti-PRSS21 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Related Product Information for anti-PRSS21 antibody
This is a rabbit polyclonal antibody against PRSS21. It was validated on Western Blot
Target Description: This gene encodes a cell-surface anchored serine protease, which is a member of the trypsin family of serine proteases. It is predicted to be active on peptide linkages involving the carboxyl group of lysine or arginine. The protein localizes to the cytoplasm and the plasma membrane of premeiotic testicular germ cells and it may be involved in progression of testicular tumors of germ cell origin. Alternative splicing of this gene results in three transcript variants encoding three different isoforms.
Target Description: This gene encodes a cell-surface anchored serine protease, which is a member of the trypsin family of serine proteases. It is predicted to be active on peptide linkages involving the carboxyl group of lysine or arginine. The protein localizes to the cytoplasm and the plasma membrane of premeiotic testicular germ cells and it may be involved in progression of testicular tumors of germ cell origin. Alternative splicing of this gene results in three transcript variants encoding three different isoforms.
Product Categories/Family for anti-PRSS21 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
testisin isoform 3 preproprotein
NCBI Official Synonym Full Names
serine protease 21
NCBI Official Symbol
PRSS21
NCBI Official Synonym Symbols
ESP1; ESP-1; TEST1; TESTISIN
NCBI Protein Information
testisin
UniProt Protein Name
Testisin
Protein Family
UniProt Gene Name
PRSS21
UniProt Synonym Gene Names
ESP1; TEST1; ESP-1
UniProt Entry Name
TEST_HUMAN
NCBI Description
This gene encodes a cell-surface anchored serine protease, which is a member of the trypsin family of serine proteases. The encoded protein is predicted to be active on peptide linkages involving the carboxyl group of lysine or arginine. The encoded protein localizes to the cytoplasm and the plasma membrane of premeiotic testicular germ cells and may be involved in progression of testicular tumors of germ cell origin. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
Research Articles on PRSS21
Similar Products
Product Notes
The PRSS21 prss21 (Catalog #AAA3211437) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRSS21 antibody - N-terminal region reacts with Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PRSS21 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRSS21 prss21 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RRVITSRIVG GEDAELGRWP WQGSLRLWDS HVCGVSLLSH RWALTAAHCF. It is sometimes possible for the material contained within the vial of "PRSS21, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
