Rabbit anti-Human PRSS2 Polyclonal Antibody | anti-PRSS2 antibody

PRSS2 (Trypsin-2, Anionic Trypsinogen, Serine Protease 2, Trypsin II, TRY2, TRYP2, MGC111183, MGC120174) (Biotin)

Cat. Num. AAA6391002

• Gene Names: PRSS2; TRY2; TRY8; TRYP2
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PRSS2; Polyclonal Antibody; PRSS2 (Trypsin-2; Anionic Trypsinogen; Serine Protease 2; Trypsin II; TRY2; TRYP2; MGC111183; MGC120174) (Biotin); anti-PRSS2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human PRSS2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-PRSS2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human PRSS2, aa1-247 (NP_002761.1).
• Immunogen Sequence: MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PRSS2 rabbit polyclonal antibody. Western Blot analysis of PRSS2 expression in human pancreas.)

Western Blot (WB)

(Western Blot analysis of PRSS2 expression in transfected 293T cell line by PRSS2 polyclonal antibody. Lane 1: PRSS2 transfected lysate (26.5kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-PRSS2 antibody

This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7.

Product Categories/Family for anti-PRSS2 antibody

Antibodies; Enzymes; Protease (Proteinase; Peptidase)

NCBI and Uniprot Product Information

• NCBI GI #: 4506147
• NCBI GeneID: 5645
• NCBI Accession #: NP_002761.1
• NCBI GenBank Nucleotide #: NM_002770
• UniProt Accession #: P07478
• Molecular Weight: 26,488 Da
• NCBI Official Full Name: trypsin-2 isoform 2 preproprotein
• NCBI Official Synonym Full Names: serine protease 2
• NCBI Official Symbol: PRSS2
• NCBI Official Synonym Symbols: TRY2; TRY8; TRYP2
• NCBI Protein Information: trypsin-2
• UniProt Protein Name: Trypsin-2
• Protein Family: Trypsin
• UniProt Gene Name: PRSS2
• UniProt Synonym Gene Names: TRY2; TRYP2
• UniProt Entry Name: TRY2_HUMAN

NCBI Description

This gene belongs to the trypsin family of serine proteases and encodes anionic trypsinogen. It is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus. Enzymes of this family cleave peptide bonds that follow lysine or arginine residues. This protein is found at high levels in pancreatic juice and its upregulation is a characteristic feature of pancreatitis. This protein has also been found to activate pro-urokinase in ovarian tumors, suggesting a function in tumor invasion. In addition, this enzyme is able to cleave across the type II collagen triple helix in rheumatoid arthritis synovitis tissue, potentially participating in the degradation of type II collagen-rich cartilage matrix. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jan 2015]

Uniprot Description

trypsin 2: In the ileum, may be involved in defensin processing, including DEFA5. Belongs to the peptidase S1 family.

Protein type: Secreted; Extracellular matrix; Secreted, signal peptide; Calcium-binding; EC 3.4.21.4; Protease; Cell adhesion

Chromosomal Location of Human Ortholog: 7q34

Cellular Component: extracellular matrix; extracellular space; extracellular region

Molecular Function: protein binding; serine-type endopeptidase activity; calcium ion binding

Biological Process: extracellular matrix disassembly; collagen catabolic process; extracellular matrix organization and biogenesis; positive regulation of cell adhesion; digestion; innate immune response; proteolysis; positive regulation of cell growth

Disease: Pancreatitis, Hereditary