Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PRSS1 rabbit polyclonal antibody. Western Blot analysis of PRSS1 expression in human pancreas.)

Rabbit anti-Human PRSS1 Polyclonal Antibody | anti-PRSS1 antibody

PRSS1 (Trypsin-1, Beta-trypsin, Cationic Trypsinogen, Serine Protease 1, Trypsin I, TRP1, TRY1, TRYP1, MGC120175, MGC149362) (AP)

Gene Names
PRSS1; TRP1; TRY1; TRY4; TRYP1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRSS1; Polyclonal Antibody; PRSS1 (Trypsin-1; Beta-trypsin; Cationic Trypsinogen; Serine Protease 1; Trypsin I; TRP1; TRY1; TRYP1; MGC120175; MGC149362) (AP); anti-PRSS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PRSS1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PRSS1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PRSS1, aa1-247 (NP_002760.1).
Immunogen Sequence
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PRSS1 rabbit polyclonal antibody. Western Blot analysis of PRSS1 expression in human pancreas.)

Western Blot (WB) (PRSS1 rabbit polyclonal antibody. Western Blot analysis of PRSS1 expression in human pancreas.)

Western Blot (WB)

(Western Blot analysis of PRSS1 expression in transfected 293T cell line by PRSS1 polyclonal antibody. Lane 1: PRSS1 transfected lysate (26.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PRSS1 expression in transfected 293T cell line by PRSS1 polyclonal antibody. Lane 1: PRSS1 transfected lysate (26.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PRSS1 antibody
Has activity against the synthetic substrates Boc-Phe-Ser-Arg-Mec, Boc-Leu-Thr-Arg-Mec, Boc-Gln-Ala-Arg-Mec and Boc-Val-Pro-Arg-Mec. The single-chain form is more active than the two-chain form against all of these substrates.
Product Categories/Family for anti-PRSS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
160,000
NCBI Official Full Name
trypsin-1 preproprotein
NCBI Official Synonym Full Names
protease, serine, 1 (trypsin 1)
NCBI Official Symbol
PRSS1
NCBI Official Synonym Symbols
TRP1; TRY1; TRY4; TRYP1
NCBI Protein Information
trypsin-1; beta-trypsin; trypsinogen 1; trypsinogen A; digestive zymogen; cationic trypsinogen; nonfunctional trypsin 1
UniProt Protein Name
Trypsin-1
Protein Family
UniProt Gene Name
PRSS1
UniProt Synonym Gene Names
TRP1; TRY1; TRYP1
UniProt Entry Name
TRY1_HUMAN

NCBI Description

This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. Mutations in this gene are associated with hereditary pancreatitis. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7. [provided by RefSeq, Jul 2008]

Uniprot Description

trypsin 1: Has activity against the synthetic substrates Boc-Phe- Ser-Arg-Mec, Boc-Leu-Thr-Arg-Mec, Boc-Gln-Ala-Arg-Mec and Boc-Val- Pro-Arg-Mec. The single-chain form is more active than the two- chain form against all of these substrates. Defects in PRSS1 are a cause of pancreatitis (PCTT). A disease characterized by the presence of calculi in pancreatic ducts. It causes severe abdominal pain attacks. Belongs to the peptidase S1 family.

Protein type: Protease; Secreted, signal peptide; Secreted; EC 3.4.21.4

Chromosomal Location of Human Ortholog: 7q34

Cellular Component: extracellular region

Molecular Function: metal ion binding; serine-type endopeptidase activity

Biological Process: extracellular matrix disassembly; extracellular matrix organization and biogenesis; vitamin metabolic process; cobalamin metabolic process; digestion; proteolysis; water-soluble vitamin metabolic process

Disease: Trypsinogen Deficiency; Pancreatitis, Hereditary

Research Articles on PRSS1

Similar Products

Product Notes

The PRSS1 prss1 (Catalog #AAA6390989) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRSS1 (Trypsin-1, Beta-trypsin, Cationic Trypsinogen, Serine Protease 1, Trypsin I, TRP1, TRY1, TRYP1, MGC120175, MGC149362) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRSS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRSS1 prss1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRSS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.