Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PRPF3Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit PRPF3 Polyclonal Antibody | anti-PRPF3 antibody

PRPF3 Antibody - C-terminal region

Gene Names
PRPF3; PRP3; RP18; HPRP3; Prp3p; HPRP3P; SNRNP90
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRPF3; Polyclonal Antibody; PRPF3 Antibody - C-terminal region; anti-PRPF3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGE
Sequence Length
683
Applicable Applications for anti-PRPF3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PRPF3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PRPF3Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PRPF3Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PRPF3 antibody
This is a rabbit polyclonal antibody against PRPF3. It was validated on Western Blot

Target Description: The removal of introns from nuclear pre-mRNAs occurs on complexes called spliceosomes, which are made up of 4 small nuclear ribonucleoprotein (snRNP) particles and an undefined number of transiently associated splicing factors. This gene product is one of several proteins that associate with U4 and U6 snRNPs. Mutations in this gene are associated with retinitis pigmentosa-18.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75kDa
NCBI Official Full Name
U4/U6 small nuclear ribonucleoprotein Prp3 isoform 1
NCBI Official Synonym Full Names
pre-mRNA processing factor 3
NCBI Official Symbol
PRPF3
NCBI Official Synonym Symbols
PRP3; RP18; HPRP3; Prp3p; HPRP3P; SNRNP90
NCBI Protein Information
U4/U6 small nuclear ribonucleoprotein Prp3
UniProt Protein Name
U4/U6 small nuclear ribonucleoprotein Prp3
UniProt Gene Name
PRPF3
UniProt Synonym Gene Names
HPRP3; PRP3; hPrp3
UniProt Entry Name
PRPF3_HUMAN

NCBI Description

The removal of introns from nuclear pre-mRNAs occurs on complexes called spliceosomes, which are made up of 4 small nuclear ribonucleoprotein (snRNP) particles and an undefined number of transiently associated splicing factors. This gene product is one of several proteins that associate with U4 and U6 snRNPs. Mutations in this gene are associated with retinitis pigmentosa-18. [provided by RefSeq, Jul 2008]

Uniprot Description

PRPF3: Participates in pre-mRNA splicing. May play a role in the assembly of the U4/U5/U6 tri-snRNP complex. Defects in PRPF3 are the cause of retinitis pigmentosa type 18 (RP18). RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. RP18 inheritance is autosomal dominant.

Protein type: RNA splicing; Spliceosome; RNA processing

Chromosomal Location of Human Ortholog: 1q21.1

Cellular Component: nucleoplasm; Cajal body; spliceosome; U4/U6 x U5 tri-snRNP complex; cytoplasm; nuclear speck; nucleus

Molecular Function: identical protein binding; protein binding

Biological Process: assembly of spliceosomal tri-snRNP; nuclear mRNA splicing, via spliceosome; RNA splicing, via transesterification reactions; RNA splicing; mRNA processing

Disease: Retinitis Pigmentosa 18

Research Articles on PRPF3

Similar Products

Product Notes

The PRPF3 prpf3 (Catalog #AAA3205311) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRPF3 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PRPF3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRPF3 prpf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RLMLHRIKWD EQTSNTKGDD DEESDEEAVK KTNKCVLVWE GTAKDRSFGE. It is sometimes possible for the material contained within the vial of "PRPF3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.