Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PRKACG expression in transfected 293T cell line by PRKACG polyclonal antibody. Lane 1: PRKACG transfected lysate (40.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human PRKACG Polyclonal Antibody | anti-PRKACG antibody

PRKACG (cAMP-dependent Protein Kinase Catalytic Subunit gamma, PKA C-gamma) (Biotin)

Gene Names
PRKACG; KAPG; PKACg
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRKACG; Polyclonal Antibody; PRKACG (cAMP-dependent Protein Kinase Catalytic Subunit gamma; PKA C-gamma) (Biotin); anti-PRKACG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PRKACG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PRKACG antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PRKACG, aa1-351 (NP_002723.2).
Immunogen Sequence
MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PRKACG expression in transfected 293T cell line by PRKACG polyclonal antibody. Lane 1: PRKACG transfected lysate (40.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PRKACG expression in transfected 293T cell line by PRKACG polyclonal antibody. Lane 1: PRKACG transfected lysate (40.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PRKACG antibody
cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase (AMPK), which transduces the signal through phosphorylation of different target proteins. The inactive holoenzyme of AMPK is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits of AMPK have been identified in humans. This protein, the gamma-catalytic subunit, is a member of the Ser/Thr protein kinase family. The gene is intronless and is thought to be a retrotransposon derived from the gene for the alpha form of the catalytic subunit.
Product Categories/Family for anti-PRKACG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,434 Da
NCBI Official Full Name
cAMP-dependent protein kinase catalytic subunit gamma
NCBI Official Synonym Full Names
protein kinase, cAMP-dependent, catalytic, gamma
NCBI Official Symbol
PRKACG
NCBI Official Synonym Symbols
KAPG; PKACg
NCBI Protein Information
cAMP-dependent protein kinase catalytic subunit gamma; PKA C-gamma; serine(threonine) protein kinase
UniProt Protein Name
cAMP-dependent protein kinase catalytic subunit gamma
UniProt Gene Name
PRKACG
UniProt Synonym Gene Names
PKA C-gamma
UniProt Entry Name
KAPCG_HUMAN

NCBI Description

Cyclic AMP-dependent protein kinase (PKA) consists of two catalytic subunits and a regulatory subunit dimer. This gene encodes the gamma form of its catalytic subunit. The gene is intronless and is thought to be a retrotransposon derived from the gene for the alpha form of the PKA catalytic subunit. [provided by RefSeq, Jul 2008]

Uniprot Description

PKACG: Phosphorylates a large number of substrates in the cytoplasm and the nucleus. A number of inactive tetrameric holoenzymes are produced by the combination of homo- or heterodimers of the different regulatory subunits associated with two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Testis specific. But important tissues such as brain and ovary have not been analyzed for the content of transcript. Activated by cAMP. Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cAMP subfamily.

Protein type: Kinase, protein; Protein kinase, AGC; EC 2.7.11.11; Protein kinase, Ser/Thr (non-receptor); AGC group; PKA family

Chromosomal Location of Human Ortholog: 9q13

Cellular Component: cytosol

Molecular Function: cAMP-dependent protein kinase activity; ATP binding

Biological Process: epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; water transport; activation of protein kinase A; male gonad development; glucose metabolic process; pathogenesis; signal transduction; protein amino acid phosphorylation; gluconeogenesis; phospholipase C activation; carbohydrate metabolic process; triacylglycerol catabolic process; energy reserve metabolic process; innate immune response; renal water homeostasis; spermatogenesis; blood coagulation; transmembrane transport; regulation of insulin secretion

Disease: Mental Retardation, Autosomal Dominant 31

Research Articles on PRKACG

Similar Products

Product Notes

The PRKACG prkacg (Catalog #AAA6390639) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRKACG (cAMP-dependent Protein Kinase Catalytic Subunit gamma, PKA C-gamma) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRKACG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRKACG prkacg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRKACG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.