Western Blot (WB)
(Host: RabbitTarget Name: PRKACBSample Tissue: Mouse NIH3T3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse PRKACB Polyclonal Antibody | anti-PRKACB antibody
PRKACB Antibody-C-terminal region
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRKACB; Polyclonal Antibody; PRKACB Antibody-C-terminal region; cAMP-dependent protein kinase catalytic subunit beta; CbPKA; Pkacb; anti-PRKACB antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
HKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEEIRVSITEKC
Applicable Applications for anti-PRKACB antibody
Western Blot (WB)
Protein Size
351 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse PRKACB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PRKACBSample Tissue: Mouse NIH3T3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PRKACBSample Tissue: Mouse NIH3T3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PRKACB antibody
Description of Target: Mediates cAMP-dependent signaling triggered by receptor binding to GPCRs. PKA activation regulates diverse cellular processes such as cell proliferation, the cell cycle, differentiation and regulation of microtubule dynamics, chromatin condensation and decondensation, nuclear envelope disassembly and reassembly, as well as regulation of intracellular transport mechanisms and ion flux. Regulates the abundance of compartmentalized pools of its regulatory subunits through phosphorylation of PJA2 which binds and ubiquitinates these subunits, leading to their subsequent proteolysis. Phosphorylates GPKOW which regulates its ability to bind RNA (By similarity).
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
41kDa
UniProt Protein Name
cAMP-dependent protein kinase catalytic subunit beta
Protein Family
UniProt Gene Name
Prkacb
UniProt Synonym Gene Names
Pkacb; PKA C-beta
UniProt Entry Name
KAPCB_MOUSE
Uniprot Description
Mediates cAMP-dependent signaling triggered by receptor binding to GPCRs. PKA activation regulates diverse cellular processes such as cell proliferation, the cell cycle, differentiation and regulation of microtubule dynamics, chromatin condensation and decondensation, nuclear envelope disassembly and reassembly, as well as regulation of intracellular transport mechanisms and ion flux. Regulates the abundance of compartmentalized pools of its regulatory subunits through phosphorylation of PJA2 which binds and ubiquitinates these subunits, leading to their subsequent proteolysis ().
Similar Products
Product Notes
The PRKACB prkacb (Catalog #AAA3249802) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRKACB Antibody-C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PRKACB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRKACB prkacb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HKWFATTDWI AIYQRKVEAP FIPKFRGSGD TSNFDDYEEE EIRVSITEKC. It is sometimes possible for the material contained within the vial of "PRKACB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
