Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PRKACA expression in transfected 293T cell line by PRKACA polyclonal antibody. Lane 1: PRKACA transfected lysate (40.6kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human PRKACA Polyclonal Antibody | anti-PRKACA antibody

PRKACA (Protein Kinase C alpha Type, AAG6, PKC-A, PKCA, PKC-alpha, MGC102831, MGC48865) (PE)

Gene Names
PRKACA; PKACA
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRKACA; Polyclonal Antibody; PRKACA (Protein Kinase C alpha Type; AAG6; PKC-A; PKCA; PKC-alpha; MGC102831; MGC48865) (PE); anti-PRKACA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PRKACA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PRKACA antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PRKACA, aa1-351 (NP_002721.1).
Immunogen Sequence
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PRKACA expression in transfected 293T cell line by PRKACA polyclonal antibody. Lane 1: PRKACA transfected lysate (40.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PRKACA expression in transfected 293T cell line by PRKACA polyclonal antibody. Lane 1: PRKACA transfected lysate (40.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PRKACA antibody
Protein kinase C (PKC) is a family of serine-and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. This protein is one of the PKC family members. This kinase has been reported to play roles in many different cellular processes, such as cell adhesion, cell transformation, cell cycle checkpoint, and cell volume control. Knockout studies in mice suggest that this kinase may be a fundamental regulator of cardiac contractility and Ca(2+) handling in myocytes.
Product Categories/Family for anti-PRKACA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
351
NCBI Official Full Name
cAMP-dependent protein kinase catalytic subunit alpha isoform 1
NCBI Official Synonym Full Names
protein kinase, cAMP-dependent, catalytic, alpha
NCBI Official Symbol
PRKACA
NCBI Official Synonym Symbols
PKACA
NCBI Protein Information
cAMP-dependent protein kinase catalytic subunit alpha; PKA C-alpha; protein kinase A catalytic subunit; cAMP-dependent protein kinase catalytic subunit alpha, isoform 1
UniProt Protein Name
cAMP-dependent protein kinase catalytic subunit alpha
UniProt Gene Name
PRKACA
UniProt Synonym Gene Names
PKACA; PKA C-alpha
UniProt Entry Name
KAPCA_HUMAN

Similar Products

Product Notes

The PRKACA prkaca (Catalog #AAA6390636) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRKACA (Protein Kinase C alpha Type, AAG6, PKC-A, PKCA, PKC-alpha, MGC102831, MGC48865) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRKACA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRKACA prkaca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRKACA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.