Rabbit anti-Human, Mouse PRKAB2 Polyclonal Antibody | anti-PRKAB2 antibody

PRKAB2 (5'-AMP-activated Protein Kinase Subunit beta-2, AMPK Subunit beta-2, MGC61468) (Biotin)

Cat. Num. AAA6390617

• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PRKAB2; Polyclonal Antibody; PRKAB2 (5'-AMP-activated Protein Kinase Subunit beta-2; AMPK Subunit beta-2; MGC61468) (Biotin); anti-PRKAB2 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human PRKAB2. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-PRKAB2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human PRKAB2, aa1-272 (NP_005390.1).
• Immunogen Sequence: MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PRKAB2 rabbit polyclonal antibody. Western Blot analysis of PRKAB2 expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of PRKAB2 expression in transfected 293T cell line by PRKAB2 polyclonal antibody. Lane 1: PRKAB2 transfected lysate (30.3kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-PRKAB2 antibody

AMPK is responsible for the regulation of fatty acid synthesis by phosphorylation of acetyl-CoA carboxylase. Also regulates cholesterol synthesis via phosphorylation and inactivation of hydroxymethylglutaryl-CoA reductase and hormone-sensitive lipase. This is a regulatory subunit, may be a positive regulator of AMPK activity. It may also serve as an adapter molecule for the catalytic alpha-subunit.

Product Categories/Family for anti-PRKAB2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4885561
• NCBI GeneID: 5565
• NCBI Accession #: NP_005390.1
• NCBI GenBank Nucleotide #: NM_005399
• UniProt Accession #: O43741; Q5VXY0; A8K9V5; B4DH06
• Molecular Weight: 21,485 Da
• NCBI Official Full Name: 5'-AMP-activated protein kinase subunit beta-2
• NCBI Official Synonym Full Names: protein kinase, AMP-activated, beta 2 non-catalytic subunit
• NCBI Official Symbol: PRKAB2
• NCBI Protein Information: 5'-AMP-activated protein kinase subunit beta-2; 5'-AMP-activated protein kinase, beta-2 subunit; AMP-activated protein kinase beta 2 non-catalytic subunit; AMPK beta 2; AMPK beta-2 chain; AMPK subunit beta-2
• UniProt Protein Name: 5'-AMP-activated protein kinase subunit beta-2
• Protein Family: 5'-AMP-activated protein kinase
• UniProt Gene Name: PRKAB2
• UniProt Synonym Gene Names: AMPK subunit beta-2
• UniProt Entry Name: AAKB2_HUMAN

NCBI Description

The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2013]

Uniprot Description

AMPKB2: a non-catalytic subunit of AMPK, a conserved kinase of the CAMKL family. AMPK is an energy-sensing protein that plays a key role in regulating cellular energy homeostasis. Environmental stress, such as heat shock, nutrient deprivation, hypoxia and ischemia, indirectly activate AMPK by the depletion of cellular ATP and the concomitant rise of ADP and AMP levels. Allosteric activation is achieved primarily by rising ADP levels, and not solely by AMP levels as previously thought. Activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton, probably by indirectly activating myosin. AMPK is a heterotrimer of an alpha catalytic subunit (AMPKA1 or -2), a beta (AMPKB1 or -2) and a gamma non-catalytic subunit (AMPKG1, -2 or -3). Different possible combinations of subunits give rise to 12 different holoenzymes. Beta subunits act as scaffolds on which the AMPK complex assembles, via its C-terminus that bridges alpha and gamma subunits. AMPK-beta1 or -beta2 subunits are required for assembling of AMPK heterotrimers and are important for regulating enzyme activity and cellular localization. AMPK beta1beta2 null mouse muscles reveal an essential role for AMPK in maintaining mitochondrial content and glucose uptake during exercise. Phosphorylation by ULK1 and ULK2 inhibits AMPK activity.

Protein type: Protein kinase, regulatory subunit; Autophagy

Chromosomal Location of Human Ortholog: 1q21.1

Cellular Component: nucleoplasm; cytosol; AMP-activated protein kinase complex

Molecular Function: AMP-activated protein kinase activity; identical protein binding; protein binding

Biological Process: mitochondrion organization and biogenesis; regulation of fatty acid biosynthetic process; organelle organization and biogenesis; insulin receptor signaling pathway; energy reserve metabolic process; carnitine shuttle; cellular lipid metabolic process; cell cycle arrest; regulation of protein kinase activity; signal transduction; protein amino acid phosphorylation; fatty acid biosynthetic process