Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PRKAB2 rabbit polyclonal antibody. Western Blot analysis of PRKAB2 expression in mouse kidney.)

Rabbit anti-Human, Mouse PRKAB2 Polyclonal Antibody | anti-PRKAB2 antibody

PRKAB2 (5'-AMP-activated Protein Kinase Subunit beta-2, AMPK Subunit beta-2, MGC61468) (Biotin)

Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRKAB2; Polyclonal Antibody; PRKAB2 (5'-AMP-activated Protein Kinase Subunit beta-2; AMPK Subunit beta-2; MGC61468) (Biotin); anti-PRKAB2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PRKAB2. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PRKAB2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PRKAB2, aa1-272 (NP_005390.1).
Immunogen Sequence
MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PRKAB2 rabbit polyclonal antibody. Western Blot analysis of PRKAB2 expression in mouse kidney.)

Western Blot (WB) (PRKAB2 rabbit polyclonal antibody. Western Blot analysis of PRKAB2 expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of PRKAB2 expression in transfected 293T cell line by PRKAB2 polyclonal antibody. Lane 1: PRKAB2 transfected lysate (30.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PRKAB2 expression in transfected 293T cell line by PRKAB2 polyclonal antibody. Lane 1: PRKAB2 transfected lysate (30.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PRKAB2 antibody
AMPK is responsible for the regulation of fatty acid synthesis by phosphorylation of acetyl-CoA carboxylase. Also regulates cholesterol synthesis via phosphorylation and inactivation of hydroxymethylglutaryl-CoA reductase and hormone-sensitive lipase. This is a regulatory subunit, may be a positive regulator of AMPK activity. It may also serve as an adapter molecule for the catalytic alpha-subunit.
Product Categories/Family for anti-PRKAB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,485 Da
NCBI Official Full Name
5'-AMP-activated protein kinase subunit beta-2
NCBI Official Synonym Full Names
protein kinase, AMP-activated, beta 2 non-catalytic subunit
NCBI Official Symbol
PRKAB2
NCBI Protein Information
5'-AMP-activated protein kinase subunit beta-2; 5'-AMP-activated protein kinase, beta-2 subunit; AMP-activated protein kinase beta 2 non-catalytic subunit; AMPK beta 2; AMPK beta-2 chain; AMPK subunit beta-2
UniProt Protein Name
5'-AMP-activated protein kinase subunit beta-2
UniProt Gene Name
PRKAB2
UniProt Synonym Gene Names
AMPK subunit beta-2
UniProt Entry Name
AAKB2_HUMAN

NCBI Description

The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2013]

Uniprot Description

AMPKB2: a non-catalytic subunit of AMPK, a conserved kinase of the CAMKL family. AMPK is an energy-sensing protein that plays a key role in regulating cellular energy homeostasis. Environmental stress, such as heat shock, nutrient deprivation, hypoxia and ischemia, indirectly activate AMPK by the depletion of cellular ATP and the concomitant rise of ADP and AMP levels. Allosteric activation is achieved primarily by rising ADP levels, and not solely by AMP levels as previously thought. Activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton, probably by indirectly activating myosin. AMPK is a heterotrimer of an alpha catalytic subunit (AMPKA1 or -2), a beta (AMPKB1 or -2) and a gamma non-catalytic subunit (AMPKG1, -2 or -3). Different possible combinations of subunits give rise to 12 different holoenzymes. Beta subunits act as scaffolds on which the AMPK complex assembles, via its C-terminus that bridges alpha and gamma subunits. AMPK-beta1 or -beta2 subunits are required for assembling of AMPK heterotrimers and are important for regulating enzyme activity and cellular localization. AMPK beta1beta2 null mouse muscles reveal an essential role for AMPK in maintaining mitochondrial content and glucose uptake during exercise. Phosphorylation by ULK1 and ULK2 inhibits AMPK activity.

Protein type: Protein kinase, regulatory subunit; Autophagy

Chromosomal Location of Human Ortholog: 1q21.1

Cellular Component: nucleoplasm; cytosol; AMP-activated protein kinase complex

Molecular Function: AMP-activated protein kinase activity; identical protein binding; protein binding

Biological Process: mitochondrion organization and biogenesis; regulation of fatty acid biosynthetic process; organelle organization and biogenesis; insulin receptor signaling pathway; energy reserve metabolic process; carnitine shuttle; cellular lipid metabolic process; cell cycle arrest; regulation of protein kinase activity; signal transduction; protein amino acid phosphorylation; fatty acid biosynthetic process

Research Articles on PRKAB2

Similar Products

Product Notes

The PRKAB2 prkab2 (Catalog #AAA6390617) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRKAB2 (5'-AMP-activated Protein Kinase Subunit beta-2, AMPK Subunit beta-2, MGC61468) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PRKAB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRKAB2 prkab2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRKAB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.