Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PRIM2 Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that PRIM2 is expressed in HepG2)

Rabbit PRIM2 Polyclonal Antibody | anti-PRIM2 antibody

PRIM2 antibody - middle region

Gene Names
PRIM2; p58; PRIM2A
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
PRIM2; Polyclonal Antibody; PRIM2 antibody - middle region; anti-PRIM2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFKSIYKPPFAS
Sequence Length
340
Applicable Applications for anti-PRIM2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PRIM2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PRIM2 Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that PRIM2 is expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-PRIM2 Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that PRIM2 is expressed in HepG2)
Related Product Information for anti-PRIM2 antibody
This is a rabbit polyclonal antibody against PRIM2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.
Product Categories/Family for anti-PRIM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Synonym Full Names
DNA primase subunit 2
NCBI Official Symbol
PRIM2
NCBI Official Synonym Symbols
p58; PRIM2A
NCBI Protein Information
DNA primase large subunit

NCBI Description

This gene encodes the 58 kilodalton subunit of DNA primase, an enzyme that plays a key role in the replication of DNA. The encoded protein forms a heterodimer with a 49 kilodalton subunit. This heterodimer functions as a DNA-directed RNA polymerase to synthesize small RNA primers that are used to create Okazaki fragments on the lagging strand of the DNA. Alternative splicing of this gene results in multiple transcript variants. This gene has a related pseudogene, which is also present on chromosome 6. [provided by RefSeq, Apr 2014]

Research Articles on PRIM2

Similar Products

Product Notes

The PRIM2 (Catalog #AAA3209380) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRIM2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PRIM2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRIM2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QDFLKDSQLQ FEAISDEEKT LREQEIVASS PSLSGLKLGF KSIYKPPFAS. It is sometimes possible for the material contained within the vial of "PRIM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.