Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Skin)

Rabbit PRDX6 Polyclonal Antibody | anti-PRDX6 antibody

PRDX6 antibody - C-terminal region

Gene Names
PRDX6; PRX; p29; AOP2; 1-Cys; NSGPx; aiPLA2; HEL-S-128m
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PRDX6; Polyclonal Antibody; PRDX6 antibody - C-terminal region; anti-PRDX6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
Sequence Length
224
Applicable Applications for anti-PRDX6 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PRDX6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Skin)

Immunohistochemistry (IHC) (Skin)

Western Blot (WB)

(WB Suggested Anti-PRDX6 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-PRDX6 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)
Related Product Information for anti-PRDX6 antibody
This is a rabbit polyclonal antibody against PRDX6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PRDX6 is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
peroxiredoxin-6
NCBI Official Synonym Full Names
peroxiredoxin 6
NCBI Official Symbol
PRDX6
NCBI Official Synonym Symbols
PRX; p29; AOP2; 1-Cys; NSGPx; aiPLA2; HEL-S-128m
NCBI Protein Information
peroxiredoxin-6
UniProt Protein Name
Peroxiredoxin-6
Protein Family
UniProt Gene Name
PRDX6
UniProt Synonym Gene Names
AOP2; KIAA0106; 1-Cys PRX; aiPLA2; NSGPx
UniProt Entry Name
PRDX6_HUMAN

NCBI Description

The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. [provided by RefSeq, Jul 2008]

Uniprot Description

PRDX6: Involved in redox regulation of the cell. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. Belongs to the AhpC/TSA family. Rehydrin subfamily.

Protein type: Amino Acid Metabolism - phenylalanine; Oxidoreductase; Energy Metabolism - methane; EC 1.11.1.9; EC 1.11.1.15; Phospholipase

Chromosomal Location of Human Ortholog: 1q25.1

Cellular Component: extracellular space; membrane; lysosome; cytoplasmic membrane-bound vesicle; cytoplasm; cytosol

Molecular Function: antioxidant activity; phospholipase A2 activity; protein binding; peroxiredoxin activity; glutathione peroxidase activity

Biological Process: response to reactive oxygen species; phospholipid catabolic process; hydrogen peroxide catabolic process; response to oxidative stress

Research Articles on PRDX6

Similar Products

Product Notes

The PRDX6 prdx6 (Catalog #AAA3208947) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRDX6 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PRDX6 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the PRDX6 prdx6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VATPVDWKDG DSVMVLPTIP EEEAKKLFPK GVFTKELPSG KKYLRYTPQP. It is sometimes possible for the material contained within the vial of "PRDX6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.