Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PPP5C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Thymus)

Rabbit PPP5C Polyclonal Antibody | anti-PPP5C antibody

PPP5C antibody - N-terminal region

Gene Names
PPP5C; PP5; PPT; PPP5
Reactivity
Cow, Guinea Pig, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPP5C; Polyclonal Antibody; PPP5C antibody - N-terminal region; anti-PPP5C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKF
Sequence Length
499
Applicable Applications for anti-PPP5C antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PPP5C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PPP5C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Thymus)

Western Blot (WB) (WB Suggested Anti-PPP5C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Thymus)
Related Product Information for anti-PPP5C antibody
This is a rabbit polyclonal antibody against PPP5C. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PPP5C may play a role in the regulation of RNA biogenesis and/or mitosis. In vitro, PPP5C dephosphorylates serine residues of skeletal muscle phosphorylase and histone H1.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 5 isoform 1
NCBI Official Synonym Full Names
protein phosphatase 5 catalytic subunit
NCBI Official Symbol
PPP5C
NCBI Official Synonym Symbols
PP5; PPT; PPP5
NCBI Protein Information
serine/threonine-protein phosphatase 5
UniProt Protein Name
Serine/threonine-protein phosphatase 5
UniProt Gene Name
PPP5C
UniProt Synonym Gene Names
PPP5; PP5; PP-T; PPT
UniProt Entry Name
PPP5_HUMAN

NCBI Description

This gene encodes a serine/threonine phosphatase which is a member of the protein phosphatase catalytic subunit family. Proteins in this family participate in pathways regulated by reversible phosphorylation at serine and threonine residues; many of these pathways are involved in the regulation of cell growth and differentiation. The product of this gene has been shown to participate in signaling pathways in response to hormones or cellular stress, and elevated levels of this protein may be associated with breast cancer development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2011]

Uniprot Description

Function: May play a role in the regulation of RNA biogenesis and/or mitosis. In vitro, dephosphorylates serine residues of skeletal muscle phosphorylase and histone H1.

Catalytic activity: A phosphoprotein + H2O = a protein + phosphate.

Cofactor: Binds 1 iron ion per subunit

By similarity.Binds 1 manganese ion per subunit

By similarity.

Subunit structure: Interacts with CDC16 and CDC27. Ref.8

Subcellular location: Nucleus. Cytoplasm. Note: Predominantly nuclear. But also present in the cytoplasm.

Tissue specificity: Ubiquitous.

Sequence similarities: Belongs to the PPP phosphatase family. PP-5 (PP-T) subfamily.Contains 3 TPR repeats.

Research Articles on PPP5C

Similar Products

Product Notes

The PPP5C ppp5c (Catalog #AAA3212935) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP5C antibody - N-terminal region reacts with Cow, Guinea Pig, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PPP5C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP5C ppp5c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAMAEGERTE CAEPPRDEPP ADGALKRAEE LKTQANDYFK AKDYENAIKF. It is sometimes possible for the material contained within the vial of "PPP5C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.