Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PPP4C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)

Rabbit PPP4C Polyclonal Antibody | anti-PPP4C antibody

PPP4C antibody - middle region

Gene Names
PPP4C; PP4; PPX; PP-X; PP4C; PPH3; PPP4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPP4C; Polyclonal Antibody; PPP4C antibody - middle region; anti-PPP4C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKP
Sequence Length
307
Applicable Applications for anti-PPP4C antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PPP4C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PPP4C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-PPP4C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)
Related Product Information for anti-PPP4C antibody
This is a rabbit polyclonal antibody against PPP4C. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PPP4C is a protein phosphatase that is involved in many processes such as microtubule organization at centrosomes, maturation of spliceosomal snRNPs, apoptosis, tumor necrosis factor (TNF)-alpha signaling, activation of c-Jun N-terminal kinase MAPK8, regulation of histone acetylation, DNA damage checkpoint signaling, NF-kappa-B activation and cell migration. The PPP4C-PPP4R1 PP4 complex may play a role in dephosphorylation and regulation of HDAC3. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AFX phosphorylated on Ser-140 (gamma-H2AFX) generated during DNA replication and required for DNA DSB repair. Dephosphorylates NDEL1 at CDC2/Cdk1 phosphorylation sites and negatively regulates CDC2/Cdk1 activity in interphase.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 4 catalytic subunit isoform 1
NCBI Official Synonym Full Names
protein phosphatase 4 catalytic subunit
NCBI Official Symbol
PPP4C
NCBI Official Synonym Symbols
PP4; PPX; PP-X; PP4C; PPH3; PPP4
NCBI Protein Information
serine/threonine-protein phosphatase 4 catalytic subunit
UniProt Protein Name
Serine/threonine-protein phosphatase 4 catalytic subunit
UniProt Gene Name
PPP4C
UniProt Synonym Gene Names
PPP4; PPX; PP4C; Pp4; PP-X
UniProt Entry Name
PP4C_HUMAN

Uniprot Description

PPP4C: a Ser/Thr phosphatase. A positive regulator of HPK1 and the HPK1-JNK signaling pathway. Mediates TNF-alpha-induced degradation of IRS-4 and plays a role in NF-kappaB p65 Thr dephosphorylation. Holoenzyme consists at least of a catalytic subunit PPP4C and a regulatory subunit PPP4R1.

Protein type: EC 3.1.3.16; Protein phosphatase, Ser/Thr (non-receptor)

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: nucleoplasm; cytoplasm; plasma membrane; microtubule organizing center; nucleus

Molecular Function: NF-kappaB-inducing kinase activity; protein binding; metal ion binding; protein serine/threonine phosphatase activity

Biological Process: dephosphorylation

Research Articles on PPP4C

Similar Products

Product Notes

The PPP4C ppp4c (Catalog #AAA3213931) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP4C antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PPP4C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP4C ppp4c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TVLTVWSAPN YCYRCGNVAA ILELDEHLQK DFIIFEAAPQ ETRGIPSKKP. It is sometimes possible for the material contained within the vial of "PPP4C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.