Western Blot (WB)
(WB Suggested Anti-PPP3CC AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)
Rabbit PPP3CC Polyclonal Antibody | anti-PPP3CC antibody
PPP3CC antibody - C-terminal region
Gene Names
PPP3CC; CNA3; CALNA3; PP2Bgamma
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPP3CC; Polyclonal Antibody; PPP3CC antibody - C-terminal region; anti-PPP3CC antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FTEPPAFGPVCDLLWSDPSEDYGNEKTLEHYTHNTVRGCSYFYSYPAVCE
Sequence Length
326
Applicable Applications for anti-PPP3CC antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 85%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-PPP3CC AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-PPP3CC AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)
Related Product Information for anti-PPP3CC antibody
This is a rabbit polyclonal antibody against PPP3CC. It was validated on Western Blot
Target Description: Calcineurin is a calcium-dependent, calmodulin-stimulated protein phosphatase involved in the downstream regulation of dopaminergic signal transduction. Calcineurin is composed of a regulatory subunit and a catalytic subunit. The protein encoded by this gene represents one of the regulatory subunits that has been found for calcineurin. Three transcript variants encoding different isoforms have been found for this gene.
Target Description: Calcineurin is a calcium-dependent, calmodulin-stimulated protein phosphatase involved in the downstream regulation of dopaminergic signal transduction. Calcineurin is composed of a regulatory subunit and a catalytic subunit. The protein encoded by this gene represents one of the regulatory subunits that has been found for calcineurin. Three transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-PPP3CC antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35kDa
NCBI Official Full Name
protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform (calcineurin A gamma), isoform CRA_b
NCBI Official Synonym Full Names
protein phosphatase 3 catalytic subunit gamma
NCBI Official Symbol
PPP3CC
NCBI Official Synonym Symbols
CNA3; CALNA3; PP2Bgamma
NCBI Protein Information
serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
Protein Family
NCBI Description
Calcineurin is a calcium-dependent, calmodulin-stimulated protein phosphatase involved in the downstream regulation of dopaminergic signal transduction. Calcineurin is composed of a regulatory subunit and a catalytic subunit. The protein encoded by this gene represents one of the regulatory subunits that has been found for calcineurin. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]
Research Articles on PPP3CC
Similar Products
Product Notes
The PPP3CC (Catalog #AAA3216537) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP3CC antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PPP3CC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP3CC for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FTEPPAFGPV CDLLWSDPSE DYGNEKTLEH YTHNTVRGCS YFYSYPAVCE. It is sometimes possible for the material contained within the vial of "PPP3CC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
